KEGG   Homo sapiens (human): 54733
Entry
54733             CDS       T01001                                 
Symbol
SLC35F2, HSNOV1
Name
(RefSeq) solute carrier family 35 member F2
  KO
K15287  solute carrier family 35, member F1/2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    54733 (SLC35F2)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC35: Nucleoside-sugar transporter
   54733 (SLC35F2)
SSDB
Motif
Pfam: SLC35F EamA CRT-like UAA Spo7 Gate
Other DBs
NCBI-GeneID: 54733
NCBI-ProteinID: NP_059985
HGNC: 23615
Ensembl: ENSG00000110660
Vega: OTTHUMG00000166366
Pharos: Q8IXU6(Tdark)
UniProt: Q8IXU6
Position
11:complement(107790991..107858787)
AA seq 374 aa
MEADSPAGPGAPEPLAEGAAAEFSSLLRRIKGKLFTWNILKTIALGQMLSLCICGTAITS
QYLAERYKVNTPMLQSFINYCLLFLIYTVMLAFRSGSDNLLVILKRKWWKYILLGLADVE
ANYVIVRAYQYTTLTSVQLLDCFGIPVLMALSWFILHARYRVIHFIAVAVCLLGVGTMVG
ADILAGREDNSGSDVLIGDILVLLGASLYAISNVCEEYIVKKLSRQEFLGMVGLFGTIIS
GIQLLIVEYKDIASIHWDWKIALLFVAFALCMFCLYSFMPLVIKVTSATSVNLGILTADL
YSLFVGLFLFGYKFSGLYILSFTVIMVGFILYCSTPTRTAEPAESSVPPVTSIGIDNLGL
KLEENLQETHSAVL
NT seq 1125 nt   +upstreamnt  +downstreamnt
atggaggcagactcgccagcgggccccggcgccccagagcccctcgcggagggagcggcg
gccgagttctccagcctgctgcgcaggataaaaggcaaactcttcacctggaatattttg
aaaacaattgccctgggtcagatgttgtccttgtgtatatgtgggacagccatcaccagc
cagtatttggcagaaagatacaaagtgaacacccccatgcttcagagctttatcaattat
tgcttgctgttcctaatttatacagtgatgctggcatttcgatcaggcagtgataacctt
ttagtaatcttgaaaagaaaatggtggaagtacatcctgctgggactagcagatgtggaa
gctaattatgtgatcgtcagagcctaccagtacacaactctaaccagtgtccagcttttg
gattgctttgggattcctgtgttgatggctctgtcatggtttattcttcatgcaagatac
agagtgatccacttcatcgccgtggctgtctgtctgttgggtgtaggaaccatggttggt
gcagacatactagcagggagggaagacaattcagggagtgatgtattgattggtgacatc
ttggtccttcttggggcttccctctatgccatttcaaatgtttgtgaggaatacatcgtg
aagaagctgagcagacaggagtttttaggaatggtgggcctgtttggaacaattatcagt
ggtatacagctattgattgtggaatataaggatattgccagcattcattgggactggaaa
attgccctgctgttcgtggcatttgccctgtgtatgttttgcctgtacagcttcatgcca
ttggtgattaaagtcactagtgccacttccgtcaacctgggcatcctgacagcggacctc
tacagcctttttgttggactctttctgtttggctataagttttcaggactctacatcctg
tccttcactgtcatcatggtggggtttatcctgtactgctccacccctactcgcacggcc
gagccggctgaaagcagcgtgcctccagtcaccagcattgggattgacaacctggggctg
aagctggaggagaacctccaggagacccactctgctgtcttgtag

DBGET integrated database retrieval system