KEGG   Homo sapiens (human): 54737
Entry
54737             CDS       T01001                                 

Gene name
MPHOSPH8, HSMPP8, TWA3, mpp8
Definition
(RefSeq) M-phase phosphoprotein 8
  KO
K21871  M-phase phosphoprotein 8
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    54737 (MPHOSPH8)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    54737 (MPHOSPH8)
SSDB
Motif
Pfam: Ank_2 Ank_5 Ank_4 Chromo Ank_3 Ank
Other DBs
NCBI-GeneID: 54737
NCBI-ProteinID: NP_059990
OMIM: 611626
HGNC: 29810
Ensembl: ENSG00000196199
Vega: OTTHUMG00000016498
Pharos: Q99549(Tbio)
UniProt: Q99549
Structure
PDB: 
3LWE 3R93 3SVM 3QO2

Position
13q12.11
AA seq 860 aa
MEQVAEGARVTAVPVSAADSTEELAEVEEGVGVVGEDNDAAARGAEAFGDSEEDGEDVFE
VEKILDMKTEGGKVLYKVRWKGYTSDDDTWEPEIHLEDCKEVLLEFRKKIAENKAKAVRK
DIQRLSLNNDIFEANSDSDQQSETKEDTSPKKKKKKLRQREEKSPDDLKKKKAKAGKLKD
KSKPDLESSLESLVFDLRTKKRISEAKEELKESKKPKKDEVKETKELKKVKKGEIRDLKT
KTREDPKENRKTKKEKFVESQVESESSVLNDSPFPEDDSEGLHSDSREEKQNTKSARERA
GQDMGLEHGFEKPLDSAMSAEEDTDVRGRRKKKTPRKAEDTRENRKLENKNAFLEKKTVP
KKQRNQDRSKSAAELEKLMPVSAQTPKGRRLSGEERGLWSTDSAEEDKETKRNESKEKYQ
KRHDSDKEEKGRKEPKGLKTLKEIRNAFDLFKLTPEEKNDVSENNRKREEIPLDFKTIDD
HKTKENKQSLKERRNTRDETDTWAYIAAEGDQEVLDSVCQADENSDGRQQILSLGMDLQL
EWMKLEDFQKHLDGKDENFAATDAIPSNVLRDAVKNGDYITVKVALNSNEEYNLDQEDSS
GMTLVMLAAAGGQDDLLRLLITKGAKVNGRQKNGTTALIHAAEKNFLTTVAILLEAGAFV
NVQQSNGETALMKACKRGNSDIVRLVIECGADCNILSKHQNSALHFAKQSNNVLVYDLLK
NHLETLSRVAEETIKDYFEARLALLEPVFPIACHRLCEGPDFSTDFNYKPPQNIPEGSGI
LLFIFHANFLGKEVIARLCGPCSVQAVVLNDKFQLPVFLDSHFVYSFSPVAGPNKLFIRL
TEAPSAKVKLLIGAYRVQLQ
NT seq 2583 nt   +upstreamnt  +downstreamnt
atggagcaggttgcggagggagcaagggtgaccgcagtccctgtgtcagctgccgacagc
actgaggagttggccgaagtcgaagaaggagttggagtagtgggcgaagataatgacgca
gccgcgagaggagcggaggcctttggcgacagtgaggaggacggagaggatgtgttcgag
gtggagaagatcctggacatgaagaccgaggggggtaaagttctttacaaagttcgctgg
aaaggctatacatcggatgatgatacctgggagcccgagattcacctggaggactgtaaa
gaagtgcttcttgaatttaggaagaaaattgcagagaacaaagccaaagcagtcaggaag
gatattcagagactatccttaaataacgacatatttgaggcgaactctgatagcgatcag
caaagtgagacaaaagaagatacttccccaaagaagaaaaagaaaaaattgaggcagaga
gaagagaaaagcccagatgatctgaaaaagaaaaaagcaaaggccgggaagctaaaagac
aagtccaaaccagacctggagagctccttggaaagtttagtttttgatttaaggacaaag
aaaagaatttctgaagccaaagaagaactaaaggagtccaaaaagcccaaaaaagatgaa
gtaaaagaaacaaaagaattaaagaaagttaaaaagggtgaaataagagatttaaagacg
aaaacaagagaagatcccaaagaaaatagaaaaacaaaaaaagaaaaatttgtcgaatcc
caggtggaatctgaatcaagtgtacttaatgattctccctttccagaggatgacagtgaa
gggctacattccgacagcagagaagagaaacaaaacactaaaagtgcaagagagagagca
gggcaggacatggggctggagcatggctttgagaagcccctagacagtgccatgagtgct
gaggaggataccgatgtcagaggcaggaggaaaaagaagaccccgagaaaggctgaggac
actagagagaacaggaagctagagaacaagaacgctttcttagagaagaaaactgtgcct
aaaaagcagaggaatcaagacagaagcaaaagtgctgcagagttagagaagctgatgcct
gtatctgcccaaacgccaaagggccggaggttgagcggggaagagagaggcctctggtcc
acggactcagccgaggaggacaaagaaaccaaaagaaatgaatccaaagaaaaatatcag
aaaaggcatgattctgacaaggaagaaaaaggcagaaaagagccaaaaggattaaagaca
cttaaggaaatcagaaatgcatttgatttatttaaattaactccagaagaaaaaaatgat
gtttctgagaataatcggaaaagggaagaaataccactggattttaaaaccatagacgat
cacaaaaccaaggaaaacaaacagtcacttaaagaaaggagaaacaccagagacgaaacg
gatacttgggcatacattgctgcagaaggtgatcaggaggttttagacagcgtgtgccaa
gcagatgagaattcagatggcaggcagcagattctgagtttgggcatggacctgcagttg
gaatggatgaagttggaagatttccaaaagcaccttgatgggaaagatgagaattttgct
gcaacagatgcaattccaagtaatgtgttaagggatgctgtgaaaaatggggattatatt
actgtaaaagttgcacttaattcaaatgaagaatataacctggaccaagaggattccagt
ggaatgacactggtgatgcttgccgccgccggagggcaggacgacctcctgcgactcctc
atcacaaaaggcgcgaaagtgaacggtcggcagaagaacgggaccaccgccctcattcat
gctgcagagaagaactttttaacaacagtggctattcttttggaagcaggagcttttgta
aatgtccagcaaagcaatggtgagactgcactgatgaaggcctgtaaaagaggaaattca
gacatcgtacgactcgtaattgaatgtggagctgactgcaatattttgtcaaagcaccag
aatagtgccctgcactttgcgaagcagtctaacaatgtgcttgtgtacgacttgctgaag
aaccatttagagacactttcaagagtagcagaagagacaataaaggattactttgaagct
cgccttgctctgctagaaccagtttttccaatcgcatgtcatcgactctgtgagggtcca
gatttttcaacagatttcaattacaaacccccacagaacataccagaaggctctggcatc
ctgctgtttatcttccatgcaaactttttgggtaaagaagttattgctcggctctgtgga
ccgtgtagtgtacaagctgtagttctgaatgataaatttcagcttcctgtttttctggac
agtcattttgtttactcattcagccctgttgcaggtcccaataaactcttcataaggttg
acagaagcaccctctgccaaggttaagttgctaataggtgcatacagagtgcagctgcag
tga

DBGET integrated database retrieval system