KEGG   Homo sapiens (human): 54754Help
Entry
54754             CDS       T01001                                 

Gene name
NUTM2F, FAM22F, NUTMF
Definition
(RefSeq) NUT family member 2F
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: NUT
Motif
Other DBs
NCBI-GeneID: 54754
NCBI-ProteinID: NP_060031
HGNC: 23450
Ensembl: ENSG00000130950
Vega: OTTHUMG00000020260
Pharos: A1L443(Tdark)
UniProt: A1L443
Position
9q22.32
AA seq 756 aa AA seqDB search
MASNGAYPVLGPGVTVNPGTSLSVFTALPFATPAPGPAHRPPLVTAVVPPAGPLVLSAFP
STPLVAGQDGRGPSGAGASNVFVQMRTEVGPVKPPQAQTLILTQAPLVWQAPGTLCGGVM
CPPPLLLAAAPGVPVTSAQVVGGTQACEGGWSHGLPLPPPPPAAQVAPIVSPGNARPWPQ
GAHGEGSLAPSQAKARPDDSCKPKSVYENFRLWQHYKPLARRHLPQSPDTEALSCFLIPV
LRSLARRKPTMTLEEGLWQAMREWQHTSNFDRMIFYEMAEKFLEFEAEEEMQIQKSQWMK
GPQSLPPPAPPRLEPRGPPAPEVVKQPVYLPSKDGPKAPTACLPPPRPQRPAETKAHLPP
PRPQRPAETNAHLPPPRPQRPAETKVPEEIPPEVVQEYVDIMEELLGSHPGDTGEPEGQR
EKGKVEQPQEEDGITSDPGLLSYIDKLCSQEDFVTKVEAVIHPRFLEELLSPDPQMDFLA
LSQELEQEEGLTLAQLVEKRLLSLKEKGCGRAAPRHGTARLDSSPSEFAAGQEAAREVPD
PQQRVSVETSPPQTAAQDPQGQGRVRTGMARSEDPAVLLGCQDSPRLKAVRPTSPPQDHR
PTCPGLGTKDALGLPGESPVKESHGLAKGSSEETELPGMVYVVGSHHRLRPWRLSQSPVP
SSGLLSPGGRGPQGALQSPSAQKRGLSPSPSPASKSKKRPLFGSPSPAEKTPHPGPGLRV
SGEQSLAWGLGGPSQSQKRKGDPLASRRKKKRHCSQ
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaaatggagcatacccagtgctgggacccggcgtgaccgtgaaccctggcacc
tccctgtctgtgttcacggctctgccctttgccacacccgctcccggcccagcacacagg
ccgcccctcgtgactgcagtggttcctccagccggccctctggtgctctctgccttcccc
agcacccctctagtggcaggacaggatggccgcggcccgagtggggccggggcttccaac
gtctttgtccagatgaggacagaagtggggcctgtgaagccccctcaggcacagaccttg
atcctaactcaggcccccctcgtctggcaggctccaggcaccctctgtggaggtgtcatg
tgtccacctcccctactcctggcagctgctcctggggtgcccgttacctctgcccaggtg
gttgggggcacccaggcctgtgagggaggctggtcccatggccttcctcttccaccacca
ccaccggctgcccaggtggcccccatcgtgtccccagggaacgctaggccatggccacaa
ggggctcatggagagggcagcctggctccctcccaggccaaggcccggccggacgactcc
tgtaaacccaagagtgtctatgagaacttccgactctggcagcactacaagcccctggcc
cggaggcaccttccccagagtcctgacactgaagcgctttcctgcttcctcatcccagtt
ctccgatccctggcccggcggaagcccaccatgacgctggaggagggactgtggcaggcc
atgcgggaatggcagcacacgagcaactttgaccggatgatcttctacgagatggcggaa
aagttcctggaatttgaggctgaggaggagatgcagattcagaaatcgcagtggatgaag
gggccccagagcctgcctcctccagccccgccgaggcttgaacctcgaggaccccctgcc
cctgaggtggtcaagcagccagtgtaccttcccagcaaggatggccccaaggccccgact
gcctgcctgccaccacccaggccccagaggccagcggagaccaaggcccacctgccacca
cccaggccccagaggccagcggagaccaacgcccacctgccaccacccaggccccagagg
ccagcggagaccaaggtccctgaggagatcccccctgaagtggtgcaggagtatgtggac
atcatggaggagctgctggggtctcaccctggggacacaggggagcctgagggacaacgg
gaaaagggcaaagtggagcagccgcaggaagaggacgggataacctcagacccgggcctc
ctgagctacattgacaagctgtgttcccaggaagactttgtcaccaaggtggaggccgtc
attcacccccgattcctggaagaattgctttccccagatccacagatggatttcttggcc
ctaagccaggagctggagcaggaggaaggactcacccttgcccagctagtggagaagcgc
ctcctgtccttgaaggagaaagggtgcgggagggcagcccctcgacatggcacggccagg
ttggactcaagtccttctgagtttgcagctggccaagaagcagcgagagaggtccctgac
ccccaacaaagggtcagcgtggaaacctccccaccccagacagctgcccaggaccctcag
ggacagggcagagtgcgcactggcatggccaggtccgaagaccctgctgtgcttttggga
tgtcaggattcccccaggctgaaggctgtccggccaacctctcctccccaggaccacaga
cccacctgccccggcctggggaccaaggacgccttgggtctccctggagagtctcctgtc
aaggagtcacatgggctggctaaggggtcaagtgaggagacggaactccctggcatggtc
tatgtcgtgggttcccaccacaggctgaggccctggaggctgtcccagagccctgtccct
tcctcgggccttctcagcccaggagggagaggaccccagggagctcttcagtctccatct
gctcagaaaagaggcctcagcccatcaccttctcctgccagcaagtccaagaagcgacct
ctctttggaagcccatcccctgctgaaaagacaccgcacccagggcctgggctcagggtc
tctggggagcaatccctggcttgggggctgggtggcccctcacagtctcaaaagagaaag
ggtgaccccttggcctccaggaggaagaagaagcggcattgtagccagtag

DBGET integrated database retrieval system