KEGG   Homo sapiens (human): 54764
Entry
54764             CDS       T01001                                 

Gene name
ZRANB1, TRABID
Definition
(RefSeq) zinc finger RANBP2-type containing 1
  KO
K11862  ubiquitin thioesterase ZRANB1 [EC:3.4.19.12]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    54764 (ZRANB1)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    54764 (ZRANB1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     54764 (ZRANB1)
Peptidases and inhibitors [BR:hsa01002]
 Cysteine peptidases
  Family C64
   54764 (ZRANB1)
Ubiquitin system [BR:hsa04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   OTU
    54764 (ZRANB1)
SSDB
Motif
Pfam: AnkUBD OTU zf-RanBP
Other DBs
NCBI-GeneID: 54764
NCBI-ProteinID: NP_060050
OMIM: 611749
HGNC: 18224
Ensembl: ENSG00000019995
Vega: OTTHUMG00000019223
Pharos: Q9UGI0(Tbio)
UniProt: Q9UGI0
Structure
PDB: 
3ZRH 5AF6

Position
10q26.13
AA seq 708 aa
MSERGIKWACEYCTYENWPSAIKCTMCRAQRPSGTIITEDPFKSGSSDVGRDWDPSSTEG
GSSPLICPDSSARPRVKSSYSMENANKWSCHMCTYLNWPRAIRCTQCLSQRRTRSPTESP
QSSGSGSRPVAFSVDPCEEYNDRNKLNTRTQHWTCSVCTYENWAKAKRCVVCDHPRPNNI
EAIELAETEEASSIINEQDRARWRGSCSSGNSQRRSPPATKRDSEVKMDFQRIELAGAVG
SKEELEVDFKKLKQIKNRMKKTDWLFLNACVGVVEGDLAAIEAYKSSGGDIARQLTADEV
RLLNRPSAFDVGYTLVHLAIRFQRQDMLAILLTEVSQQAAKCIPAMVCPELTEQIRREIA
ASLHQRKGDFACYFLTDLVTFTLPADIEDLPPTVQEKLFDEVLDRDVQKELEEESPIINW
SLELATRLDSRLYALWNRTAGDCLLDSVLQATWGIYDKDSVLRKALHDSLHDCSHWFYTR
WKDWESWYSQSFGLHFSLREEQWQEDWAFILSLASQPGASLEQTHIFVLAHILRRPIIVY
GVKYYKSFRGETLGYTRFQGVYLPLLWEQSFCWKSPIALGYTRGHFSALVAMENDGYGNR
GAGANLNTDDDVTITFLPLVDSERKLLHVHFLSAQELGNEEQQEKLLREWLDCCVTEGGV
LVAMQKSSRRRNHPLVTQMVEKWLDRYRQIRPCTSLSDGEEDEDDEDE
NT seq 2127 nt   +upstreamnt  +downstreamnt
atgtcagaacgtggaattaagtgggcttgtgaatattgtacgtatgaaaactggccatct
gcaatcaagtgtactatgtgtcgtgcccaaagacctagtggaacaattattacagaagat
ccatttaaaagtggttcaagtgatgttggtagagattgggatccttccagcaccgaagga
ggaagtagtcctttgatatgtccagactctagtgcaagaccaagggtgaaatcttcgtat
agcatggaaaatgcaaataagtggtcatgccacatgtgtacatatttgaactggccaaga
gcaatcagatgtacccagtgcttatcccaacgtaggaccaggagtcctacagaatctcct
cagtcctcaggatctggctcaagaccagttgctttttctgttgatccttgtgaggaatac
aatgatagaaataaactgaacactaggacacagcactggacttgctctgtttgcacatat
gaaaactgggccaaggctaaaagatgtgttgtttgtgatcatcccagacctaataacatt
gaagcaatagaattggcagagactgaagaggcttcttcaataataaatgagcaagacaga
gctcgatggaggggaagttgcagtagtggtaatagccaaaggagatcacctcctgctacg
aagcgggactctgaagtgaaaatggattttcagaggattgaattggctggtgctgtggga
agcaaggaggaacttgaagtagactttaaaaaactaaagcaaattaaaaacaggatgaaa
aagactgattggctcttcctcaatgcttgtgtgggggttgtagaaggtgatttagctgcc
atagaagcatacaagtcatcaggaggagacattgcacgtcagctcaccgcagatgaagta
cgcttgctgaatcgtccttctgcctttgatgttggctatactcttgtacacttggctata
cgttttcagaggcaggatatgctagcaatattgcttacagaggtgtctcaacaagcagca
aagtgtattccagcaatggtgtgtcctgaactgacagaacaaatccggagagagatagct
gcctctcttcatcagagaaagggggattttgcttgctattttctgactgaccttgtaaca
tttacattgccagcagatattgaagatttgcccccaacagtccaagaaaaattatttgat
gaggtgcttgatagagacgttcaaaaagaattagaagaagaatctccaattattaactgg
tccttggaattggctacacgtttggacagtcgactgtatgcactttggaaccggactgca
ggagactgcctacttgattcagttctacaagctacctggggcatctatgacaaggactca
gtgcttcggaaagccctgcatgacagcctgcatgactgttcacattggttttacacacgc
tggaaagattgggaatcatggtattctcagagctttggtttacatttttccttgagagaa
gaacagtggcaagaagactgggcatttatactctctcttgctagtcagcctggagcaagc
ttggagcagacgcacatttttgtactggcacatattcttagacgaccaattatagtttat
ggagtaaaatattacaagagtttccggggagaaactttaggatatactcggtttcaaggt
gtttatctgcctttgttgtgggaacagagtttttgttggaaaagtccgattgctctgggt
tatacgaggggccacttctctgctttggttgccatggaaaatgatggctatggcaaccga
ggtgctggtgctaatctcaataccgatgatgatgtcaccatcacatttttgcctctggtt
gacagtgaaaggaagctactccatgtgcacttcctttctgctcaggagctaggtaatgag
gaacagcaagaaaaactgctcagggagtggctggactgctgtgtgacggaggggggagtt
ctggttgccatgcagaagagttctcggcggcgaaatcaccccctggtcactcagatggta
gaaaaatggcttgaccgctaccgacagatccggccgtgtacatccctgtctgatggagag
gaagatgaggatgatgaagatgaatga

DBGET integrated database retrieval system