KEGG   Homo sapiens (human): 54784Help
Entry
54784             CDS       T01001                                 

Gene name
ALKBH4, ABH4
Definition
(RefSeq) alkB homolog 4, lysine demethylase
  KO
K10766  alkylated DNA repair protein alkB homolog 4 [EC:1.14.11.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    54784 (ALKBH4)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.-  
     54784 (ALKBH4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2OG-FeII_Oxy_2
Motif
Other DBs
NCBI-GeneID: 54784
NCBI-ProteinID: NP_060091
OMIM: 613302
HGNC: 21900
Ensembl: ENSG00000160993
Vega: OTTHUMG00000157720
Pharos: Q9NXW9(Tdark)
UniProt: Q9NXW9
Position
7q22.1
AA seq 302 aa AA seqDB search
MAAAAAETPEVLRECGCKGIRTCLICERQRGSDPPWELPPAKTYRFIYCSDTGWAVGTEE
SDFEGWAFPFPGVMLIEDFVTREEEAELVRLMDRDPWKLSQSGRRKQDYGPKVNFRKQKL
KTEGFCGLPSFSREVVRRMGLYPGLEGFRPVEQCNLDYCPERGSAIDPHLDDAWLWGERL
VSLNLLSPTVLSMCREAPGSLLLCSAPSAAPEALVDSVIAPSRSVLCQEVEVAIPLPARS
LLVLTGAARHQWKHAIHRRHIEARRVCVTFRELSAEFGPGGRQQELGQELLRIALSFQGR
PV
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggctgccgccgagacccccgaagtccttcgggaatgcggttgcaagggcatc
cggacctgtctgatctgcgagcggcagcgcggcagtgacccgccctgggagctgccccca
gcgaaaacataccgtttcatttactgctccgacaccggctgggccgtgggcacagaggag
tctgactttgagggctgggccttccccttcccaggagtgatgctgatcgaggactttgtg
acccgggaggaagaagccgagttggtgcggctcatggaccgtgacccctggaagctctcc
cagtctggacggaggaagcaggactatggccccaaagtcaactttcggaaacagaagcta
aagaccgagggcttctgcggcctccccagcttcagccgggaggtggtgcggaggatgggc
ctctacccggggctggagggcttccggcccgtcgagcagtgcaacctggactactgcccc
gagcggggctctgccattgacccccacctggacgacgcctggctgtggggggagcggctg
gtcagcctcaacctcctgtcccccaccgtgctgtccatgtgtcgggaggcgcccgggagc
ctgctcctctgctcggccccgtcggctgccccggaggccttggtggacagcgtgatagca
cccagccggtcggtgctatgccaggaggtggaggtggccatccccttacccgcccgctcc
ctgctggtcctcaccggggcggcacggcaccagtggaagcatgccatccaccgcagacac
atcgaggcccgccgcgtctgcgtcactttccgggagctgtcggctgagtttggccctgga
gggaggcagcaagagctgggccaggaactgctgcggatcgccctctccttccagggaaga
cccgtgtga

DBGET integrated database retrieval system