KEGG   Homo sapiens (human): 54788Help
Entry
54788             CDS       T01001                                 

Gene name
DNAJB12, DJ10
Definition
(RefSeq) DnaJ heat shock protein family (Hsp40) member B12
  KO
K09518  DnaJ homolog subfamily B member 12
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    54788 (DNAJB12)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP40 / DNAJ
   54788 (DNAJB12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF1977 DnaJ TPR_2 TPR_19 TPR_1
Motif
Other DBs
NCBI-GeneID: 54788
NCBI-ProteinID: NP_001002762
OMIM: 608376
HGNC: 14891
Ensembl: ENSG00000148719
Vega: OTTHUMG00000018436
Pharos: Q9NXW2(Tdark)
UniProt: Q9NXW2 J3KPS0
Structure
PDB: 

Position
10q22.1
AA seq 409 aa AA seqDB search
MSSLRARLPATRRRVAQPFARPASPSLVPRSGSAMESNKDEAERCISIALKAIQSNQPDR
ALRFLEKAQRLYPTPRVRALIESLNQKPQTAGDQPPPTDTTHATHRKAGGTDAPSANGEA
GGESTKGYTAEQVAAVKRVKQCKDYYEILGVSRGASDEDLKKAYRRLALKFHPDKNHAPG
ATEAFKAIGTAYAVLSNPEKRKQYDQFGDDKSQAARHGHGHGDFHRGFEADISPEDLFNM
FFGGGFPSSNVHVYSNGRMRYTYQQRQDRRDNQGDGGLGVFVQLMPILILILVSALSQLM
VSSPPYSLSPRPSVGHIHRRVTDHLGVVYYVGDTFSEEYTGSSLKTVERNVEDDYIANLR
NNCWKEKQQKEGLLYRARYFGDTDMYHRAQKMGTPSCSRLSEVQASLHG
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcactccgcgcccggctgcccgcgacgcgccggcgggtggcgcagcccttcgct
cgcccggcctccccctccctggttccgcgttctggttccgccatggaatccaacaaggat
gaagctgagcgctgtatcagcatcgccctcaaggccatccagagcaaccagcccgaccgg
gcgctccgcttcctggagaaggcacagcggctgtatccgacgccgcgagttcgcgccctg
attgagtccctcaaccagaaaccacagactgccggtgaccaacccccacccacagacaca
acccatgccacccacaggaaagcaggtgggaccgatgccccctcggccaacggtgaagct
ggaggagagagcaccaaaggctacactgcagaacaggttgcagctgtgaaaagggtcaag
caatgtaaagattactatgagatcctgggggtgagcagaggggcctcggatgaggacctg
aagaaggcctaccgcagactggccctcaaattccacccagacaagaaccacgcacctggt
gccactgaagccttcaaagccattggcacagcatatgcggtactcagcaacccggagaag
aggaagcagtatgaccagttcggcgatgacaagagccaggcggcccggcacggccatggg
catggggatttccaccgtggctttgaggccgacatctcccctgaagacctcttcaacatg
ttctttggcggcggcttcccttctagtaacgtccacgtctacagcaacggccgcatgcgc
tatacctaccagcaaaggcaggaccgcagggacaaccagggtgatggcgggctaggggtg
tttgtgcagctgatgcctatcctcatcctgattctcgtgtcagctctcagccagctcatg
gtctccagtccaccctacagtctgagtccaagaccgtccgtgggccacatccacaggcga
gtcactgaccacctgggtgtcgtctactatgtgggagacactttctccgaagagtacaca
ggctccagcctcaaaacagtcgagcggaatgtggaagatgattatatcgccaacctccgg
aacaactgctggaaggagaagcagcagaaggaaggcttgctgtaccgggcacgctacttt
ggcgacacagatatgtaccacagagcacagaagatgggcacccccagctgcagccgactg
tcagaggtgcaggcctccctgcatggatag

DBGET integrated database retrieval system