KEGG   Homo sapiens (human): 54790Help
Entry
54790             CDS       T01001                                 

Gene name
TET2, KIAA1546, MDS
Definition
(RefSeq) tet methylcytosine dioxygenase 2
Organism
hsa  Homo sapiens (human)
Disease
H01481  Myelodysplastic syndrome (MDS)
H01892  Peripheral T cell lymphoma (PTCL)
SSDB OrthologParalogGFIT
Motif
Pfam: Tet_JBP
Motif
Other DBs
NCBI-GeneID: 54790
NCBI-ProteinID: NP_001120680
OMIM: 612839
HGNC: 25941
Ensembl: ENSG00000168769
Vega: OTTHUMG00000131213
Pharos: Q6N021(Tbio)
UniProt: Q6N021 A0A158SIU0
Structure
PDB: 

Position
4q24
AA seq 2002 aa AA seqDB search
MEQDRTNHVEGNRLSPFLIPSPPICQTEPLATKLQNGSPLPERAHPEVNGDTKWHSFKSY
YGIPCMKGSQNSRVSPDFTQESRGYSKCLQNGGIKRTVSEPSLSGLLQIKKLKQDQKANG
ERRNFGVSQERNPGESSQPNVSDLSDKKESVSSVAQENAVKDFTSFSTHNCSGPENPELQ
ILNEQEGKSANYHDKNIVLLKNKAVLMPNGATVSASSVEHTHGELLEKTLSQYYPDCVSI
AVQKTTSHINAINSQATNELSCEITHPSHTSGQINSAQTSNSELPPKPAAVVSEACDADD
ADNASKLAAMLNTCSFQKPEQLQQQKSVFEICPSPAENNIQGTTKLASGEEFCSGSSSNL
QAPGGSSERYLKQNEMNGAYFKQSSVFTKDSFSATTTPPPPSQLLLSPPPPLPQVPQLPS
EGKSTLNGGVLEEHHHYPNQSNTTLLREVKIEGKPEAPPSQSPNPSTHVCSPSPMLSERP
QNNCVNRNDIQTAGTMTVPLCSEKTRPMSEHLKHNPPIFGSSGELQDNCQQLMRNKEQEI
LKGRDKEQTRDLVPPTQHYLKPGWIELKAPRFHQAESHLKRNEASLPSILQYQPNLSNQM
TSKQYTGNSNMPGGLPRQAYTQKTTQLEHKSQMYQVEMNQGQSQGTVDQHLQFQKPSHQV
HFSKTDHLPKAHVQSLCGTRFHFQQRADSQTEKLMSPVLKQHLNQQASETEPFSNSHLLQ
HKPHKQAAQTQPSQSSHLPQNQQQQQKLQIKNKEEILQTFPHPQSNNDQQREGSFFGQTK
VEECFHGENQYSKSSEFETHNVQMGLEEVQNINRRNSPYSQTMKSSACKIQVSCSNNTHL
VSENKEQTTHPELFAGNKTQNLHHMQYFPNNVIPKQDLLHRCFQEQEQKSQQASVLQGYK
NRNQDMSGQQAAQLAQQRYLIHNHANVFPVPDQGGSHTQTPPQKDTQKHAALRWHLLQKQ
EQQQTQQPQTESCHSQMHRPIKVEPGCKPHACMHTAPPENKTWKKVTKQENPPASCDNVQ
QKSIIETMEQHLKQFHAKSLFDHKALTLKSQKQVKVEMSGPVTVLTRQTTAAELDSHTPA
LEQQTTSSEKTPTKRTAASVLNNFIESPSKLLDTPIKNLLDTPVKTQYDFPSCRCVEQII
EKDEGPFYTHLGAGPNVAAIREIMEERFGQKGKAIRIERVIYTGKEGKSSQGCPIAKWVV
RRSSSEEKLLCLVRERAGHTCEAAVIVILILVWEGIPLSLADKLYSELTETLRKYGTLTN
RRCALNEERTCACQGLDPETCGASFSFGCSWSMYYNGCKFARSKIPRKFKLLGDDPKEEE
KLESHLQNLSTLMAPTYKKLAPDAYNNQIEYEHRAPECRLGLKEGRPFSGVTACLDFCAH
AHRDLHNMQNGSTLVCTLTREDNREFGGKPEDEQLHVLPLYKVSDVDEFGSVEAQEEKKR
SGAIQVLSSFRRKVRMLAEPVKTCRQRKLEAKKAAAEKLSSLENSSNKNEKEKSAPSRTK
QTENASQAKQLAELLRLSGPVMQQSQQPQPLQKQPPQPQQQQRPQQQQPHHPQTESVNSY
SASGSTNPYMRRPNPVSPYPNSSHTSDIYGSTSPMNFYSTSSQAAGSYLNSSNPMNPYPG
LLNQNTQYPSYQCNGNLSVDNCSPYLGSYSPQSQPMDLYRYPSQDPLSKLSLPPIHTLYQ
PRFGNSQSFTSKYLGYGNQNMQGDGFSSCTIRPNVHHVGKLPPYPTHEMDGHFMGATSRL
PPNLSNPNMDYKNGEHHSPSHIIHNYSAAPGMFNSSLHALHLQNKENDMLSHTANGLSKM
LPALNHDRTACVQGGLHKLSDANGQEKQPLALVQGVASGAEDNDEVWSDSEQSFLDPDIG
GVAVAPTHGSILIECAKRELHATTPLKNPNRNHPTRISLVFYQHKSMNEPKHGLALWEAK
MAEKAREKEEECEKYGPDYVPQKSHGKKVKREPAEPHETSEPTYLRFIKSLAERTMSVTT
DSTVTTSPYAFTRVTGPYNRYI
NT seq 6009 nt NT seq  +upstreamnt  +downstreamnt
atggaacaggatagaaccaaccatgttgagggcaacagactaagtccattcctgatacca
tcacctcccatttgccagacagaacctctggctacaaagctccagaatggaagcccactg
cctgagagagctcatccagaagtaaatggagacaccaagtggcactctttcaaaagttat
tatggaataccctgtatgaagggaagccagaatagtcgtgtgagtcctgactttacacaa
gaaagtagagggtattccaagtgtttgcaaaatggaggaataaaacgcacagttagtgaa
ccttctctctctgggctccttcagatcaagaaattgaaacaagaccaaaaggctaatgga
gaaagacgtaacttcggggtaagccaagaaagaaatccaggtgaaagcagtcaaccaaat
gtctccgatttgagtgataagaaagaatctgtgagttctgtagcccaagaaaatgcagtt
aaagatttcaccagtttttcaacacataactgcagtgggcctgaaaatccagagcttcag
attctgaatgagcaggaggggaaaagtgctaattaccatgacaagaacattgtattactt
aaaaacaaggcagtgctaatgcctaatggtgctacagtttctgcctcttccgtggaacac
acacatggtgaactcctggaaaaaacactgtctcaatattatccagattgtgtttccatt
gcggtgcagaaaaccacatctcacataaatgccattaacagtcaggctactaatgagttg
tcctgtgagatcactcacccatcgcatacctcagggcagatcaattccgcacagacctct
aactctgagctgcctccaaagccagctgcagtggtgagtgaggcctgtgatgctgatgat
gctgataatgccagtaaactagctgcaatgctaaatacctgttcctttcagaaaccagaa
caactacaacaacaaaaatcagtttttgagatatgcccatctcctgcagaaaataacatc
cagggaaccacaaagctagcgtctggtgaagaattctgttcaggttccagcagcaatttg
caagctcctggtggcagctctgaacggtatttaaaacaaaatgaaatgaatggtgcttac
ttcaagcaaagctcagtgttcactaaggattccttttctgccactaccacaccaccacca
ccatcacaattgcttctttctccccctcctcctcttccacaggttcctcagcttccttca
gaaggaaaaagcactctgaatggtggagttttagaagaacaccaccactaccccaaccaa
agtaacacaacacttttaagggaagtgaaaatagagggtaaacctgaggcaccaccttcc
cagagtcctaatccatctacacatgtatgcagcccttctccgatgctttctgaaaggcct
cagaataattgtgtgaacaggaatgacatacagactgcagggacaatgactgttccattg
tgttctgagaaaacaagaccaatgtcagaacacctcaagcataacccaccaatttttggt
agcagtggagagctacaggacaactgccagcagttgatgagaaacaaagagcaagagatt
ctgaagggtcgagacaaggagcaaacacgagatcttgtgcccccaacacagcactatctg
aaaccaggatggattgaattgaaggcccctcgttttcaccaagcggaatcccatctaaaa
cgtaatgaggcatcactgccatcaattcttcagtatcaacccaatctctccaatcaaatg
acctccaaacaatacactggaaattccaacatgcctggggggctcccaaggcaagcttac
acccagaaaacaacacagctggagcacaagtcacaaatgtaccaagttgaaatgaatcaa
gggcagtcccaaggtacagtggaccaacatctccagttccaaaaaccctcacaccaggtg
cacttctccaaaacagaccatttaccaaaagctcatgtgcagtcactgtgtggcactaga
tttcattttcaacaaagagcagattcccaaactgaaaaacttatgtccccagtgttgaaa
cagcacttgaatcaacaggcttcagagactgagccattttcaaactcacaccttttgcaa
cataagcctcataaacaggcagcacaaacacaaccatcccagagttcacatctccctcaa
aaccagcaacagcagcaaaaattacaaataaagaataaagaggaaatactccagactttt
cctcacccccaaagcaacaatgatcagcaaagagaaggatcattctttggccagactaaa
gtggaagaatgttttcatggtgaaaatcagtattcaaaatcaagcgagttcgagactcat
aatgtccaaatgggactggaggaagtacagaatataaatcgtagaaattccccttatagt
cagaccatgaaatcaagtgcatgcaaaatacaggtttcttgttcaaacaatacacaccta
gtttcagagaataaagaacagactacacatcctgaactttttgcaggaaacaagacccaa
aacttgcatcacatgcaatattttccaaataatgtgatcccaaagcaagatcttcttcac
aggtgctttcaagaacaggagcagaagtcacaacaagcttcagttctacagggatataaa
aatagaaaccaagatatgtctggtcaacaagctgcgcaacttgctcagcaaaggtacttg
atacataaccatgcaaatgtttttcctgtgcctgaccagggaggaagtcacactcagacc
cctccccagaaggacactcaaaagcatgctgctctaaggtggcatctcttacagaagcaa
gaacagcagcaaacacagcaaccccaaactgagtcttgccatagtcagatgcacaggcca
attaaggtggaacctggatgcaagccacatgcctgtatgcacacagcaccaccagaaaac
aaaacatggaaaaaggtaactaagcaagagaatccacctgcaagctgtgataatgtgcag
caaaagagcatcattgagaccatggagcagcatctgaagcagtttcacgccaagtcgtta
tttgaccataaggctcttactctcaaatcacagaagcaagtaaaagttgaaatgtcaggg
ccagtcacagttttgactagacaaaccactgctgcagaacttgatagccacaccccagct
ttagagcagcaaacaacttcttcagaaaagacaccaaccaaaagaacagctgcttctgtt
ctcaataattttatagagtcaccttccaaattactagatactcctataaaaaatttattg
gatacacctgtcaagactcaatatgatttcccatcttgcagatgtgtagagcaaattatt
gaaaaagatgaaggtcctttttatacccatctaggagcaggtcctaatgtggcagctatt
agagaaatcatggaagaaaggtttggacagaagggtaaagctattaggattgaaagagtc
atctatactggtaaagaaggcaaaagttctcagggatgtcctattgctaagtgggtggtt
cgcagaagcagcagtgaagagaagctactgtgtttggtgcgggagcgagctggccacacc
tgtgaggctgcagtgattgtgattctcatcctggtgtgggaaggaatcccgctgtctctg
gctgacaaactctactcggagcttaccgagacgctgaggaaatacggcacgctcaccaat
cgccggtgtgccttgaatgaagagagaacttgcgcctgtcaggggctggatccagaaacc
tgtggtgcctccttctcttttggttgttcatggagcatgtactacaatggatgtaagttt
gccagaagcaagatcccaaggaagtttaagctgcttggggatgacccaaaagaggaagag
aaactggagtctcatttgcaaaacctgtccactcttatggcaccaacatataagaaactt
gcacctgatgcatataataatcagattgaatatgaacacagagcaccagagtgccgtctg
ggtctgaaggaaggccgtccattctcaggggtcactgcatgtttggacttctgtgctcat
gcccacagagacttgcacaacatgcagaatggcagcacattggtatgcactctcactaga
gaagacaatcgagaatttggaggaaaacctgaggatgagcagcttcacgttctgccttta
tacaaagtctctgacgtggatgagtttgggagtgtggaagctcaggaggagaaaaaacgg
agtggtgccattcaggtactgagttcttttcggcgaaaagtcaggatgttagcagagcca
gtcaagacttgccgacaaaggaaactagaagccaagaaagctgcagctgaaaagctttcc
tccctggagaacagctcaaataaaaatgaaaaggaaaagtcagccccatcacgtacaaaa
caaactgaaaacgcaagccaggctaaacagttggcagaacttttgcgactttcaggacca
gtcatgcagcagtcccagcagccccagcctctacagaagcagccaccacagccccagcag
cagcagagaccccagcagcagcagccacatcaccctcagacagagtctgtcaactcttat
tctgcttctggatccaccaatccatacatgagacggcccaatccagttagtccttatcca
aactcttcacacacttcagatatctatggaagcaccagccctatgaacttctattccacc
tcatctcaagctgcaggttcatatttgaattcttctaatcccatgaacccttaccctggg
cttttgaatcagaatacccaatatccatcatatcaatgcaatggaaacctatcagtggac
aactgctccccatatctgggttcctattctccccagtctcagccgatggatctgtatagg
tatccaagccaagaccctctgtctaagctcagtctaccacccatccatacactttaccag
ccaaggtttggaaatagccagagttttacatctaaatacttaggttatggaaaccaaaat
atgcagggagatggtttcagcagttgtaccattagaccaaatgtacatcatgtagggaaa
ttgcctccttatcccactcatgagatggatggccacttcatgggagccacctctagatta
ccacccaatctgagcaatccaaacatggactataaaaatggtgaacatcattcaccttct
cacataatccataactacagtgcagctccgggcatgttcaacagctctcttcatgccctg
catctccaaaacaaggagaatgacatgctttcccacacagctaatgggttatcaaagatg
cttccagctcttaaccatgatagaactgcttgtgtccaaggaggcttacacaaattaagt
gatgctaatggtcaggaaaagcagccattggcactagtccagggtgtggcttctggtgca
gaggacaacgatgaggtctggtcagacagcgagcagagctttctggatcctgacattggg
ggagtggccgtggctccaactcatgggtcaattctcattgagtgtgcaaagcgtgagctg
catgccacaacccctttaaagaatcccaataggaatcaccccaccaggatctccctcgtc
ttttaccagcataagagcatgaatgagccaaaacatggcttggctctttgggaagccaaa
atggctgaaaaagcccgtgagaaagaggaagagtgtgaaaagtatggcccagactatgtg
cctcagaaatcccatggcaaaaaagtgaaacgggagcctgctgagccacatgaaacttca
gagcccacttacctgcgtttcatcaagtctcttgccgaaaggaccatgtccgtgaccaca
gactccacagtaactacatctccatatgccttcactcgggtcacagggccttacaacaga
tatatatga

DBGET integrated database retrieval system