KEGG   Homo sapiens (human): 54795Help
Entry
54795             CDS       T01001                                 

Gene name
TRPM4, LTrpC4, PFHB1B, TRPM4B, hTRPM4
Definition
(RefSeq) transient receptor potential cation channel subfamily M member 4
  KO
K04979  transient receptor potential cation channel subfamily M member 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04911  Insulin secretion
Disease
H01263  Progressive cardiac conduction defect (PCCD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    54795 (TRPM4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    54795 (TRPM4)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   54795 (TRPM4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LSDAT_euk LSDAT_prok Ion_trans
Motif
Other DBs
NCBI-GeneID: 54795
NCBI-ProteinID: NP_060106
OMIM: 606936
HGNC: 17993
Ensembl: ENSG00000130529
Vega: OTTHUMG00000183184
Pharos: Q8TD43(Tchem)
UniProt: Q8TD43
Structure
PDB: 

Position
19q13.33
AA seq 1214 aa AA seqDB search
MVVPEKEQSWIPKIFKKKTCTTFIVDSTDPGGTLCQCGRPRTAHPAVAMEDAFGAAVVTV
WDSDAHTTEKPTDAYGELDFTGAGRKHSNFLRLSDRTDPAAVYSLVTRTWGFRAPNLVVS
VLGGSGGPVLQTWLQDLLRRGLVRAAQSTGAWIVTGGLHTGIGRHVGVAVRDHQMASTGG
TKVVAMGVAPWGVVRNRDTLINPKGSFPARYRWRGDPEDGVQFPLDYNYSAFFLVDDGTH
GCLGGENRFRLRLESYISQQKTGVGGTGIDIPVLLLLIDGDEKMLTRIENATQAQLPCLL
VAGSGGAADCLAETLEDTLAPGSGGARQGEARDRIRRFFPKGDLEVLQAQVERIMTRKEL
LTVYSSEDGSEEFETIVLKALVKACGSSEASAYLDELRLAVAWNRVDIAQSELFRGDIQW
RSFHLEASLMDALLNDRPEFVRLLISHGLSLGHFLTPMRLAQLYSAAPSNSLIRNLLDQA
SHSAGTKAPALKGGAAELRPPDVGHVLRMLLGKMCAPRYPSGGAWDPHPGQGFGESMYLL
SDKATSPLSLDAGLGQAPWSDLLLWALLLNRAQMAMYFWEMGSNAVSSALGACLLLRVMA
RLEPDAEEAARRKDLAFKFEGMGVDLFGECYRSSEVRAARLLLRRCPLWGDATCLQLAMQ
ADARAFFAQDGVQSLLTQKWWGDMASTTPIWALVLAFFCPPLIYTRLITFRKSEEEPTRE
ELEFDMDSVINGEGPVGTADPAEKTPLGVPRQSGRPGCCGGRCGGRRCLRRWFHFWGAPV
TIFMGNVVSYLLFLLLFSRVLLVDFQPAPPGSLELLLYFWAFTLLCEELRQGLSGGGGSL
ASGGPGPGHASLSQRLRLYLADSWNQCDLVALTCFLLGVGCRLTPGLYHLGRTVLCIDFM
VFTVRLLHIFTVNKQLGPKIVIVSKMMKDVFFFLFFLGVWLVAYGVATEGLLRPRDSDFP
SILRRVFYRPYLQIFGQIPQEDMDVALMEHSNCSSEPGFWAHPPGAQAGTCVSQYANWLV
VLLLVIFLLVANILLVNLLIAMFSYTFGKVQGNSDLYWKAQRYRLIREFHSRPALAPPFI
VISHLRLLLRQLCRRPRSPQPSSPALEHFRVYLSKEAERKLLTWESVHKENFLLARARDK
RESDSERLKRTSQKVDLALKQLGHIREYEQRLKVLEREVQQCSRVLGWVAEALSRSALLP
PGGPPPPDLPGSKD
NT seq 3645 nt NT seq  +upstreamnt  +downstreamnt
atggtggtgccggagaaggagcagagctggatccccaagatcttcaagaagaagacctgc
acgacgttcatagttgactccacagatccgggagggaccttgtgccagtgtgggcgcccc
cggaccgcccaccccgcagtggccatggaggatgccttcggggcagccgtggtgaccgtg
tgggacagcgatgcacacaccacggagaagcccaccgatgcctacggagagctggacttc
acgggggccggccgcaagcacagcaatttcctccggctctctgaccgaacggatccagct
gcagtttatagtctggtcacacgcacatggggcttccgtgccccgaacctggtggtgtca
gtgctggggggatcggggggccccgtcctccagacctggctgcaggacctgctgcgtcgt
gggctggtgcgggctgcccagagcacaggagcctggattgtcactgggggtctgcacacg
ggcatcggccggcatgttggtgtggctgtacgggaccatcagatggccagcactgggggc
accaaggtggtggccatgggtgtggccccctggggtgtggtccggaatagagacaccctc
atcaaccccaagggctcgttccctgcgaggtaccggtggcgcggtgacccggaggacggg
gtccagtttcccctggactacaactactcggccttcttcctggtggacgacggcacacac
ggctgcctggggggcgagaaccgcttccgcttgcgcctggagtcctacatctcacagcag
aagacgggcgtgggagggactggaattgacatccctgtcctgctcctcctgattgatggt
gatgagaagatgttgacgcgaatagagaacgccacccaggctcagctcccatgtctcctc
gtggctggctcagggggagctgcggactgcctggcggagaccctggaagacactctggcc
ccagggagtgggggagccaggcaaggcgaagcccgagatcgaatcaggcgtttctttccc
aaaggggaccttgaggtcctgcaggcccaggtggagaggattatgacccggaaggagctc
ctgacagtctattcttctgaggatgggtctgaggaattcgagaccatagttttgaaggcc
cttgtgaaggcctgtgggagctcggaggcctcagcctacctggatgagctgcgtttggct
gtggcttggaaccgcgtggacattgcccagagtgaactctttcggggggacatccaatgg
cggtccttccatctcgaagcttccctcatggacgccctgctgaatgaccggcctgagttc
gtgcgcttgctcatttcccacggcctcagcctgggccacttcctgaccccgatgcgcctg
gcccaactctacagcgcggcgccctccaactcgctcatccgcaaccttttggaccaggcg
tcccacagcgcaggcaccaaagccccagccctaaaagggggagctgcggagctccggccc
cctgacgtggggcatgtgctgaggatgctgctggggaagatgtgcgcgccgaggtacccc
tccgggggcgcctgggaccctcacccaggccagggcttcggggagagcatgtatctgctc
tcggacaaggccacctcgccgctctcgctggatgctggcctcgggcaggccccctggagc
gacctgcttctttgggcactgttgctgaacagggcacagatggccatgtacttctgggag
atgggttccaatgcagtttcctcagctcttggggcctgtttgctgctccgggtgatggca
cgcctggagcctgacgctgaggaggcagcacggaggaaagacctggcgttcaagtttgag
gggatgggcgttgacctctttggcgagtgctatcgcagcagtgaggtgagggctgcccgc
ctcctcctccgtcgctgcccgctctggggggatgccacttgcctccagctggccatgcaa
gctgacgcccgtgccttctttgcccaggatggggtacagtctctgctgacacagaagtgg
tggggagatatggccagcactacacccatctgggccctggttctcgccttcttttgccct
ccactcatctacacccgcctcatcaccttcaggaaatcagaagaggagcccacacgggag
gagctagagtttgacatggatagtgtcattaatggggaagggcctgtcgggacggcggac
ccagccgagaagacgccgctgggggtcccgcgccagtcgggccgtccgggttgctgcggg
ggccgctgcggggggcgccggtgcctacgccgctggttccacttctggggcgcgccggtg
accatcttcatgggcaacgtggtcagctacctgctgttcctgctgcttttctcgcgggtg
ctgctcgtggatttccagccggcgccgcccggctccctggagctgctgctctatttctgg
gctttcacgctgctgtgcgaggaactgcgccagggcctgagcggaggcgggggcagcctc
gccagcgggggccccgggcctggccatgcctcactgagccagcgcctgcgcctctacctc
gccgacagctggaaccagtgcgacctagtggctctcacctgcttcctcctgggcgtgggc
tgccggctgaccccgggtttgtaccacctgggccgcactgtcctctgcatcgacttcatg
gttttcacggtgcggctgcttcacatcttcacggtcaacaaacagctggggcccaagatc
gtcatcgtgagcaagatgatgaaggacgtgttcttcttcctcttcttcctcggcgtgtgg
ctggtagcctatggcgtggccacggaggggctcctgaggccacgggacagtgacttccca
agtatcctgcgccgcgtcttctaccgtccctacctgcagatcttcgggcagattccccag
gaggacatggacgtggccctcatggagcacagcaactgctcgtcggagcccggcttctgg
gcacaccctcctggggcccaggcgggcacctgcgtctcccagtatgccaactggctggtg
gtgctgctcctcgtcatcttcctgctcgtggccaacatcctgctggtcaacttgctcatt
gccatgttcagttacacattcggcaaagtacagggcaacagcgatctctactggaaggcg
cagcgttaccgcctcatccgggaattccactctcggcccgcgctggccccgccctttatc
gtcatctcccacttgcgcctcctgctcaggcaattgtgcaggcgaccccggagcccccag
ccgtcctccccggccctcgagcatttccgggtttacctttctaaggaagccgagcggaag
ctgctaacgtgggaatcggtgcataaggagaactttctgctggcacgcgctagggacaag
cgggagagcgactccgagcgtctgaagcgcacgtcccagaaggtggacttggcactgaaa
cagctgggacacatccgcgagtacgaacagcgcctgaaagtgctggagcgggaggtccag
cagtgtagccgcgtcctggggtgggtggccgaggccctgagccgctctgccttgctgccc
ccaggtgggccgccaccccctgacctgcctgggtccaaagactga

DBGET integrated database retrieval system