KEGG   Homo sapiens (human): 54799Help
Entry
54799             CDS       T01001                                 

Gene name
MBTD1, SA49P01
Definition
(RefSeq) mbt domain containing 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: MBT
Motif
Other DBs
NCBI-GeneID: 54799
NCBI-ProteinID: NP_060113
HGNC: 19866
Ensembl: ENSG00000011258
Vega: OTTHUMG00000150442
Pharos: Q05BQ5(Tdark)
UniProt: Q05BQ5
Structure
PDB: 

Position
17q21.33
AA seq 628 aa AA seqDB search
MFDGYDSCSEDTSSSSSSEESEEEVAPLPSNLPIIKNNGQVYTYPDGKSGMATCEMCGMV
GVRDAFYSKTKRFCSVSCSRSYSSNSKKASILARLQGKPPTKKAKVLQKQPLVAKLAAYA
QYQATLQNQAKTKAAVSMEGFSWGNYINSNSFIAAPVTCFKHAPMGTCWGDISENVRVEV
PNTDCSLPTKVFWIAGIVKLAGYNALLRYEGFENDSGLDFWCNICGSDIHPVGWCAASGK
PLVPPRTIQHKYTNWKAFLVKRLTGAKTLPPDFSQKVSESMQYPFKPCMRVEVVDKRHLC
RTRVAVVESVIGGRLRLVYEESEDRTDDFWCHMHSPLIHHIGWSRSIGHRFKRSDITKKQ
DGHFDTPPHLFAKVKEVDQSGEWFKEGMKLEAIDPLNLSTICVATIRKVLADGFLMIGID
GSEAADGSDWFCYHATSPSIFPVGFCEINMIELTPPRGYTKLPFKWFDYLRETGSIAAPV
KLFNKDVPNHGFRVGMKLEAVDLMEPRLICVATVTRIIHRLLRIHFDGWEEEYDQWVDCE
SPDLYPVGWCQLTGYQLQPPASQSSRENQSASSKQKKKAKSQQYKGHKKMTTLQLKEELL
DGEDYNFLQGASDQESNGSANFYIKQEP
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgtttgacggttatgatagctgcagtgaggacacaagcagcagctccagctccgaagag
agtgaggaagaagtcgctcctttaccttctaatctcccgattatcaaaaacaatgggcaa
gtctacacatacccagatggtaaatctggcatggctacctgtgagatgtgtgggatggtt
ggcgtccgagatgctttttactctaaaacaaagcgtttctgtagcgtttcatgttcaaga
agttactcgtcaaactccaagaaggcaagcattttggccagacttcagggtaagcctcca
acaaagaaagcaaaagttcttcagaaacaacctttagttgctaagctagccgcatatgct
cagtatcaagctaccttgcaaaatcaagcaaagacaaaagcagcagtctccatggaaggt
ttcagctggggtaactacatcaatagcaatagctttatagcagctccggttacctgtttt
aaacatgcacctatggggacctgctggggtgatatctcagaaaatgtgagagtagaagtt
cccaatacagactgcagcctacctaccaaagtcttctggattgctggaattgtaaaatta
gcaggttacaatgcccttttaagatatgaaggatttgaaaatgactctggtctggacttc
tggtgcaatatatgtggttctgatatccatccagttggttggtgtgcagccagcggaaaa
cctcttgttcctcctagaactattcagcataaatatacaaactggaaagcttttctagtg
aaacgacttactggtgccaaaacactgcctcctgatttctcccaaaaggtttcagagagt
atgcagtatcctttcaaaccttgcatgagagtagaagtggttgacaagaggcatttgtgt
cgaacacgagtagcagtggtggaaagtgtaattggaggaagattaagactagtgtatgaa
gaaagcgaagatagaacagatgacttctggtgccatatgcacagcccattaatacatcat
attggttggtctcgaagcataggtcatcgattcaaaagatctgatattacaaagaaacag
gatggacattttgatacaccaccacatttatttgctaaggtaaaagaagtagaccagagt
ggggaatggttcaaggaaggaatgaaattggaagctatagacccattaaatctttctaca
atatgtgtcgcaaccattagaaaggtgctagctgacggattcctgatgattgggatcgat
ggctcagaagcagcagacggatctgactggttctgttaccatgcaacctctccttctatt
ttccctgtcggtttctgtgaaattaacatgattgaacttactccacccagaggttacaca
aaacttccttttaaatggtttgactacctcagggaaactggctccattgcagcaccagta
aaactatttaataaggatgttccaaatcacggatttcgtgtaggaatgaaattagaagca
gtagatctcatggagccacgtttaatatgtgtagccacagtaactcgaattattcatcgt
ctcttgaggatacattttgatggatgggaagaagagtatgatcagtgggtagactgtgag
tcacctgacctctatcctgtagggtggtgtcagttaactggatatcaactacagcctcca
gcatcacagtcatcaagagaaaaccaatcagcttcatcaaaacagaagaaaaaggctaag
tcccagcaatacaaaggacataagaaaatgacaacactgcagctgaaggaggagttgctg
gatggagaggattataatttccttcaaggagcgtctgatcaggaaagcaatggctctgcc
aacttctacatcaaacaagagccatga

DBGET integrated database retrieval system