KEGG   Homo sapiens (human): 5481Help
Entry
5481              CDS       T01001                                 

Gene name
PPID, CYP-40, CYPD
Definition
(RefSeq) peptidylprolyl isomerase D
  KO
K05864  peptidyl-prolyl isomerase D [EC:5.2.1.8]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    5481 (PPID)
   04218 Cellular senescence
    5481 (PPID)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    5481 (PPID)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     5481 (PPID)
Chaperones and folding catalysts [BR:hsa03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    5481 (PPID)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase TPR_1 TPR_2 TPR_7 TPR_11 TPR_12 TPR_9 TPR_16 TPR_17 TPR_19
Motif
Other DBs
NCBI-GeneID: 5481
NCBI-ProteinID: NP_005029
OMIM: 601753
HGNC: 9257
Ensembl: ENSG00000171497
Vega: OTTHUMG00000161927
Pharos: Q08752(Tchem)
UniProt: Q08752 E5KN55
Position
4q32.1
AA seq 370 aa AA seqDB search
MSHPSPQAKPSNPSNPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGH
TTGKPLHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSM
ANAGRNTNGSQFFITTVPTPHLDGKHVVFGQVIKGIGVARILENVEVKGEKPAKLCVIAE
CGELKEGDDGGIFPKDGSGDSHPDFPEDADIDLKDVDKILLITEDLKNIGNTFFKSQNWE
MAIKKYAEVLRYVDSSKAVIETADRAKLQPIALSCVLNIGACKLKMSNWQGAIDSCLEAL
ELDPSNTKALYRRAQGWQGLKEYDQALADLKKAQGIAPEDKAIQAELLKVKQKIKAQKDK
EKAVYAKMFA
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcacccgtccccccaagccaagccctccaaccccagtaaccctcgagtcttcttt
gacgtggacatcggaggggagcgagttggtcgaattgtcttagaattgtttgcagatatc
gtacccaaaactgcggaaaattttcgtgcactgtgtacaggagaaaaaggcattggacac
acgactgggaaacctctccatttcaaaggatgcccttttcatcgaattattaagaaattt
atgattcagggtggagacttctcaaatcagaatgggacaggtggagaaagtatttatggt
gaaaaatttgaagatgaaaatttccattacaagcatgatcgggagggtttactgagcatg
gcaaatgcaggccgcaacacaaacggttctcagttttttatcacaacagttccaactcct
catttggatgggaaacatgtggtgtttggccaagtaattaaaggaataggagtggcaagg
atattggaaaatgtggaagtgaaaggtgaaaaacctgctaaattgtgcgttattgcagaa
tgtggagaattgaaggaaggagatgacgggggaatattcccaaaagatggctctggcgac
agtcatccagatttccctgaggatgcggatatagatttaaaagatgtagataaaatttta
ttaataacagaagacttaaaaaacattggaaatacttttttcaaatcccagaactgggag
atggctattaaaaaatatgcagaagttttaagatacgtggacagttcaaaggctgttatt
gagacagcagatagagccaagctgcaacctatagctttaagctgtgtactgaatattggt
gcttgtaaactgaagatgtcaaattggcagggagcaattgacagttgtttagaggctctt
gaactagacccatcaaataccaaagcattgtaccgcagagctcaaggatggcaaggatta
aaagaatatgatcaagcattggctgatcttaagaaagctcaggggatagcaccagaagat
aaagctatccaggcagaattgctgaaagtcaaacaaaagataaaggcacagaaagataaa
gagaaggcagtatatgcaaaaatgtttgcttag

DBGET integrated database retrieval system