KEGG   Homo sapiens (human): 54829
Entry
54829             CDS       T01001                                 

Gene name
ASPN, OS3, PLAP-1, PLAP1, SLRR1C
Definition
(RefSeq) asporin
  KO
K08120  asporin
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:hsa00535]
    54829 (ASPN)
Proteoglycans [BR:hsa00535]
 Extracellular matrix (ECM) proteoglycans
  Small leucine-rich proteoglycan (SLRP) family
   class I
    54829 (ASPN)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_5 LRR_9 LRRNT LRR_1
Other DBs
NCBI-GeneID: 54829
NCBI-ProteinID: NP_060150
OMIM: 608135
HGNC: 14872
Ensembl: ENSG00000106819
Vega: OTTHUMG00000020227
Pharos: Q9BXN1(Tbio)
UniProt: Q9BXN1 Q6P528
Position
9q22.31
AA seq 379 aa
MKEYVLLLFLALCSAKPFFSPSHIALKNMMLKDMEDTDDDDDDDDDDDDDEDNSLFPTRE
PRSHFFPFDLFPMCPFGCQCYSRVVHCSDLGLTSVPTNIPFDTRMLDLQNNKIKEIKEND
FKGLTSLYGLILNNNKLTKIHPKAFLTTKKLRRLYLSHNQLSEIPLNLPKSLAELRIHEN
KVKKIQKDTFKGMNALHVLEMSANPLDNNGIEPGAFEGVTVFHIRIAEAKLTSVPKGLPP
TLLELHLDYNKISTVELEDFKRYKELQRLGLGNNKITDIENGSLANIPRVREIHLENNKL
KKIPSGLPELKYLQIIFLHSNSIARVGVNDFCPTVPKMKKSLYSAISLFNNPVKYWEMQP
ATFRCVLSRMSVQLGNFGM
NT seq 1140 nt   +upstreamnt  +downstreamnt
atgaaggagtatgtgctcctattattcctggctttgtgctctgccaaacccttctttagc
ccttcacacatcgcactgaagaatatgatgctgaaggatatggaagacacagatgatgat
gatgatgatgatgatgatgatgatgatgatgaggacaactctctttttccaacaagagag
ccaagaagccatttttttccatttgatctgtttccaatgtgtccatttggatgtcagtgc
tattcacgagttgtacattgctcagatttaggtttgacctcagtcccaaccaacattcca
tttgatactcgaatgcttgatcttcaaaacaataaaattaaggaaatcaaagaaaatgat
tttaaaggactcacttcactttatggtctgatcctgaacaacaacaagctaacgaagatt
cacccaaaagcctttctaaccacaaagaagttgcgaaggctgtatctgtcccacaatcaa
ctaagtgaaataccacttaatcttcccaaatcattagcagaactcagaattcatgaaaat
aaagttaagaaaatacaaaaggacacattcaaaggaatgaatgctttacacgttttggaa
atgagtgcaaaccctcttgataataatgggatagagccaggggcatttgaaggggtgacg
gtgttccatatcagaattgcagaagcaaaactgacctcagttcctaaaggcttaccacca
actttattggagcttcacttagattataataaaatttcaacagtggaacttgaggatttt
aaacgatacaaagaactacaaaggctgggcctaggaaacaacaaaatcacagatatcgaa
aatgggagtcttgctaacataccacgtgtgagagaaatacatttggaaaacaataaacta
aaaaaaatcccttcaggattaccagagttgaaatacctccagataatcttccttcattct
aattcaattgcaagagtgggagtaaatgacttctgtccaacagtgccaaagatgaagaaa
tctttatacagtgcaataagtttattcaacaacccggtgaaatactgggaaatgcaacct
gcaacatttcgttgtgttttgagcagaatgagcgttcagcttgggaactttggaatgtaa

DBGET integrated database retrieval system