KEGG   Homo sapiens (human): 54836Help
Entry
54836             CDS       T01001                                 

Gene name
BSPRY
Definition
(RefSeq) B-box and SPRY domain containing
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: PRY SPRY zf-B_box
Motif
Other DBs
NCBI-GeneID: 54836
NCBI-ProteinID: NP_060158
HGNC: 18232
Ensembl: ENSG00000119411
Vega: OTTHUMG00000021006
Pharos: Q5W0U4(Tdark)
UniProt: Q5W0U4
Position
9q32
AA seq 402 aa AA seqDB search
MSAEGAEPGPGSGSGPGPGPLCPEHGQALSWFCGSERRPVCAACAGLGGRCRGHRIRRAE
ERAEELRNKIVDQCERLQLQSAAITKYVADVLPGKNQRAVSMASAARELVIQRLSLVRSL
CESEEQRLLEQVHGEEERAHQSILTQRVHWAEALQKLDTIRTGLVGMLTHLDDLQLIQKE
QEIFERTEEAEGILDPQESEMLNFNEKCTRSPLLTQLWATAVLGSLSGTEDIRIDERTVS
PFLQLSDDRKTLTFSTKKSKACADGPERFDHWPNALAATSFQNGLHAWMVNVQNSCAYKV
GVASGHLPRKGSGSDCRLGHNAFSWVFSRYDQEFRFSHNGQHEPLGLLRGPAQLGVVLDL
QVQELLFYEPASGTVLCAHHVSFPGPLFPVFAVADQTISIVR
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccgagggcgcggagccggggccggggtccgggtccgggcccgggccggggcca
ctctgccccgaacacggccaggctctgagctggttctgcggctccgagcgacggcccgtg
tgcgccgcctgcgcggggttgggcggtcgctgccgggggcaccgcatccgccgggcggag
gagcgcgccgaggagctgcggaacaagattgtggaccagtgtgagaggctgcagttacag
agtgctgccatcaccaagtatgtggcggacgtcctgccggggaagaatcaaagagcagtg
agcatggccagtgcagcgagggaactggttatccagcggttgagtctggtgaggagtctt
tgcgagagcgaggagcagcggttactggaacaggtgcatggcgaagaggagcgggcccac
cagagcatcctgacacagcgggtgcactgggccgaggcgctgcagaaacttgacaccatc
cgcactggcctggtgggcatgcttactcacctggatgacctccagctgattcagaaggag
caagagattttcgagaggaccgaagaagcagagggcattttggatccccaggagtcggaa
atgttaaactttaatgagaagtgcactcggagcccactactgacccaactctgggcaacg
gcggttcttgggtctctctcaggcacagaggacatacggatcgatgagaggacagtcagc
cccttcctgcaattgtcagatgatcgaaagaccctgaccttcagcaccaagaagtcaaag
gcctgtgcagatggcccggagcgcttcgaccactggcccaatgccctggctgccacctcc
ttccagaatgggctccatgcctggatggtgaatgtccagaacagttgtgcctataaggtg
ggcgtggcttcaggccacctgccccgcaagggttctggcagtgactgccgtctgggccac
aatgccttctcctgggtcttctctcgctatgatcaggagtttcgtttctcacacaatggg
cagcacgagcccctggggctgctgcggggcccagcccagctgggtgtagtgctggacttg
caggttcaggagctgctcttctatgagccagcctccggcacagtgctctgtgcccatcat
gtgtccttcccggggcccctcttcccagtctttgctgtggccgatcagaccatttctatc
gtccgctga

DBGET integrated database retrieval system