KEGG   Homo sapiens (human): 54848
Entry
54848             CDS       T01001                                 

Gene name
ARHGEF38
Definition
(RefSeq) Rho guanine nucleotide exchange factor 38
  KO
K20711  Rho guanine nucleotide exchange factor 38
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    54848 (ARHGEF38)
Membrane trafficking [BR:hsa04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    54848 (ARHGEF38)
SSDB
Motif
Pfam: RhoGEF SH3_2 SH3_9 SH3_1 tRNA_bind_3 DUF29
Other DBs
NCBI-GeneID: 54848
NCBI-ProteinID: NP_001229658
HGNC: 25968
Ensembl: ENSG00000236699
Vega: OTTHUMG00000154752
Pharos: Q9NXL2(Tdark)
UniProt: Q9NXL2
Position
4q24
AA seq 777 aa
MEPKEATGKENMVTKKKNLAFLRSRLYMLERRKTDTVVESSVSGDHSGTLRRSQSDRTEY
NQKLQEKMTPQGECSVAETLTPEEEHHMKRMMAKREKIIKELIQTEKDYLNDLELCVREV
VQPLRNKKTDRLDVDSLFSNIESVHQISAKLLSLLEEATTDVEPAMQVIGEVFLQIKGPL
EDIYKIYCYHHDEAHSILESYEKEEELKEHLSHCIQSLKKIYMQEGKPNLLDMGSLMIKP
IQRVMKYPLLLCELRNSTPPSHPDYRALDDAFAAVKDINVNINELKRRKDLVLKYKKNDE
DESLKDKLSKLNIHSISKKSKRVTNHLKILTRGESQVKDNTFNREEKLFRALEKTVRLCV
KNISLCLQHIQDAMPLALQSVMDLQEISYNKDDEMDYSETLSNALNSCHDFASHLQRLIL
TPLSALLSLFPGPHKLIQKRYDKLLDCNSYLQRSTGEESDLAKKEYEALNAQLVEELQAF
NQAARKILLNCLCSFITLLRDLMLVAQQAYSTLVPMPLLVSSISEIQNQVLEEIQNLNCV
KENSATFIERKLSFEKKKPVQILPEMPHQTDIHRSKLLSTYSAEELYQAKRKCNATQEYD
INLLEGDLVAVIEQKDPLGSTSRWLVDTGNVKGYVYSSFLKPYNPAKMQKVDAENRFCDD
DFENISLFVSSRPASDSVTGTSESSIGDSSSSLSGTCGKFETNGTDVDSFQEVDEQIFYA
VHAFQARSDHELSLQEYQRVHILRFCDLSGNKEWWLAEAQGQKGYVPANYLGKMTYA
NT seq 2334 nt   +upstreamnt  +downstreamnt
atggagcccaaagaagccactgggaaagaaaacatggtcaccaagaaaaagaatctggcc
ttcttgaggtctagactctatatgctggagagaaggaagactgacactgtggttgagagc
agtgtttctggggaccactctggcaccttgaggaggagccaatctgacaggaccgaatac
aaccagaaattacaagaaaagatgactccacagggtgagtgttctgtagctgagacctta
accccagaggaagagcatcatatgaagaggatgatggcaaagcgggaaaagatcattaag
gagctgatacagacagaaaaggattatctcaatgatctagagctgtgtgttagggaagtg
gttcagcccctgagaaataaaaagactgataggctggatgtggatagcttgtttagcaac
attgagtccgtgcatcagatatcagccaagctgctgtcattgttggaagaggccacaaca
gacgtggaaccggccatgcaagtaattggagaagtattcttgcagattaaagggccactg
gaagatatttataaaatctactgctatcaccatgatgaagcacatagtatactggagtcc
tatgaaaaggaagaagagctgaaggaacatttgagccactgtatccagtccttaaagaaa
atatacatgcaagaaggcaaaccaaacttattggacatgggctctttgatgatcaaacca
attcaacgtgtgatgaaataccccctattactgtgcgaacttcggaattccacccctccc
tctcacccagattacagagcactggacgatgcctttgctgctgtgaaggacattaatgtt
aacatcaatgaacttaaaagaaggaaagatttagttctaaaatacaagaagaatgacgag
gatgaatcacttaaagacaaattgtctaaactaaatattcattcaattagcaagaaatca
aaaagagtgacaaatcatctgaagattctgaccagaggagaatcacaggttaaagacaat
acctttaacagagaagaaaagctgtttagagctttagaaaagactgtgaggctttgtgtg
aagaacatttcactctgtcttcaacacatacaggatgccatgcccctggctctgcagagt
gtgatggaccttcaggagatttcatacaacaaagacgatgagatggactattctgagacc
ctaagtaatgccttaaattcgtgtcatgactttgcatctcacttacagagactcatcctg
acccccttgtcagccctgctgtccttattcccagggcctcacaagctcatccagaaacgc
tatgacaaactgctggattgcaacagctacctgcagcgatcaacgggagaggagtcagac
ttggccaaaaaggagtatgaggccctcaacgcccagcttgtggaggagctccaggcattc
aaccaggctgctcggaagattctgttgaactgtctatgcagcttcattaccctccttagg
gacctgatgctcgtggcacagcaggcttactccacacttgtgccgatgccactgttggtt
tcaagcatttctgagattcagaatcaagtactagaagagatccaaaatttgaattgtgtg
aaagaaaacagtgccacctttattgagaggaaactcagttttgaaaagaagaaacctgtg
cagattctgccagaaatgccacatcaaactgacattcatcgctccaaacttctatccaca
tatagtgcagaggaactctatcaagctaagcgcaagtgcaatgctacacaagaatatgac
atcaatcttctggaaggagacttggtggctgtgatagaacagaaagatccactggggagt
acaagcaggtggcttgtggacacaggaaatgtgaaaggatatgtttattcctccttccta
aaaccctacaatccagcaaaaatgcagaaagtggatgctgagaacaggttctgtgacgat
gattttgagaacatcagcctcttcgtgtcttcacggccagctagtgacagtgtcacaggc
acctcagaaagcagcattggtgatagcagctcatctcttagtggcacatgtggaaagttt
gaaacaaatggtactgatgttgacagttttcaagaagtagacgaacagattttctatgca
gttcatgcttttcaagcacggagtgaccatgaactcagccttcaggaataccagagagtt
catatactcaggttttgtgacctaagtggcaataaagagtggtggttagctgaagctcaa
gggcagaaaggatacgtgccagctaactaccttggaaagatgacttatgcttaa

DBGET integrated database retrieval system