KEGG   Homo sapiens (human): 54851Help
Entry
54851             CDS       T01001                                 

Gene name
ANKRD49, FGIF, GBIF
Definition
(RefSeq) ankyrin repeat domain 49
  KO
K21439  ankyrin repeat domain-containing protein 49
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_4 Ank Ank_5 Ank_2 Ank_3
Motif
Other DBs
NCBI-GeneID: 54851
NCBI-ProteinID: NP_060174
HGNC: 25970
Ensembl: ENSG00000168876
Vega: OTTHUMG00000167793
Pharos: Q8WVL7(Tdark)
UniProt: Q8WVL7 A0A024R398
Position
11q21
AA seq 239 aa AA seqDB search
MEKEKGNDDGIPDQENSLDFSEHFNQLELLETHGHLIPTGTQSLWVGNSDEDEEQDDKNE
EWYRLQEKKMEKDPSRLLLWAAEKNRLTTVRRLLSEKATHVNTRDEDEYTPLHRAAYSGH
LDIVQELIAQGADVHAVTVDGWTPLHSACKWNNTRVASFLLQHDADINAQTKGLLTPLHL
AAGNRDSKDTLELLLMNRYVKPGLKNNLEETAFDIARRTSIYHYLFEIVEGCTNSSPQS
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagaaaaaggaaatgatgatggaataccagaccaagagaattccttggatttt
tctgaacactttaaccaacttgaattgttggaaacacatggacaccttattcctactggt
actcaaagtctttgggtaggcaattctgatgaagatgaggagcaagatgacaaaaatgaa
gagtggtatcgattgcaagaaaaaaaaatggaaaaagacccaagcagattgcttctttgg
gctgctgaaaaaaatcggcttaccacagtgcggagactcctttctgaaaaggccactcac
gtgaacactagggatgaagatgagtatacccctcttcatcgagcagcctacagtggacac
ttagatattgttcaggagctcattgcacagggggccgatgttcatgcagtgactgtggat
ggctggacgcccctgcacagtgcttgtaagtggaataataccagagtggcttctttctta
ctgcagcatgatgcagatatcaatgcccaaacaaaaggcctcttgacccccttgcatctt
gctgctgggaacagagacagcaaggataccctagaactcctcctgatgaaccgttacgtc
aaaccagggctgaaaaacaacttggaagaaactgcatttgatattgccaggaggacaagt
atctatcactacctctttgaaattgtggaaggctgtacaaattcttcacctcagtcttaa

DBGET integrated database retrieval system