KEGG   Homo sapiens (human): 548593Help
Entry
548593            CDS       T01001                                 

Gene name
SLX1A, GIYD1
Definition
(RefSeq) SLX1 homolog A, structure-specific endonuclease subunit
  KO
K15078  structure-specific endonuclease subunit SLX1 [EC:3.6.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    548593 (SLX1A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    548593 (SLX1A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.-  
     548593 (SLX1A)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Other HR factors
     548593 (SLX1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GIY-YIG FANCL_C
Motif
Other DBs
NCBI-GeneID: 548593
NCBI-ProteinID: NP_001014999
OMIM: 615822
HGNC: 20922
Ensembl: ENSG00000132207
Vega: OTTHUMG00000176859
UniProt: Q9BQ83
Position
16p11.2
AA seq 275 aa AA seqDB search
MGPAGVAARPGRFFGVYLLYCLNPRYRGRVYVGFTVNTARRVQQHNGGRKKGGAWRTSGR
GPWEMVLVVHGFPSSVAALRFEWAWQHPHASRRLAHVGPRLRGETAFAFHLRVLAHMLRA
PPWARLPLTLRWVRPDLRQDLCLPPPPHVPLAFGPPPPQAPAPRRRAGPFDDAEPEPDQG
DPGACCSLCAQTIQDEEGPLCCPHPGCLLRAHVICLAEEFLQEEPGQLLPLEGQCPCCEK
SLLWGDLIWLCQMDTEKEVEDSELEEAHWTDLLET
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgggtcccgcgggggtcgcggcgaggccagggcgctttttcggcgtctacctgctctac
tgcctgaacccccggtaccggggccgcgtctacgtggggttcactgtcaacactgctcgt
cgggtccagcagcacaatgggggccgcaaaaaaggcggggcctggcggaccagcgggcga
gggccctgggagatggtgctcgtcgtgcacggcttcccgtcctccgtggccgcccttcgg
tttgagtgggcttggcagcacccgcacgcctcgcgccgcctggcgcacgtggggcctcgc
ctgcgaggagagacagccttcgctttccacctgcgcgtgctggcgcacatgctgcgcgca
ccgccctgggctcgcctcccgctcacgctgcgctgggtgcgcccagacctccgccaggac
ctctgcctcccgccgccgccgcacgtgcctctggccttcgggcctccaccgccccaggcc
ccggccccaaggcgccgcgcaggtccctttgatgacgcggagcctgagccagaccagggg
gatccaggggcctgctgctccctgtgcgcccagaccatccaggatgaagaggggcccttg
tgttgcccccaccctggctgcctgctaagggcccatgtgatctgcctggcagaggagttt
cttcaggaagaaccagggcagcttctgcccctagagggccaatgcccttgctgtgagaag
tcactgctttggggagacctgatctggctgtgccagatggacactgagaaagaagtagaa
gactcagaattagaagaggcacactggacagacctgctggagacctga

DBGET integrated database retrieval system