KEGG   Homo sapiens (human): 548596Help
Entry
548596            CDS       T01001                                 

Gene name
CKMT1A, CKMT1, U-MtCK, mia-CK
Definition
(RefSeq) creatine kinase, mitochondrial 1A
  KO
K00933  creatine kinase [EC:2.7.3.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00330  Arginine and proline metabolism
hsa01100  Metabolic pathways
Module
hsa_M00047  Creatine pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    548596 (CKMT1A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    548596 (CKMT1A)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.2  creatine kinase
     548596 (CKMT1A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   548596 (CKMT1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-gua_Ptrans ATP-gua_PtransN
Motif
Other DBs
NCBI-GeneID: 548596
NCBI-ProteinID: NP_001015001
OMIM: 613415
HGNC: 31736
Ensembl: ENSG00000223572
Vega: OTTHUMG00000059898
Pharos: P12532(Tbio)
UniProt: P12532
Structure
PDB: 

Position
15q15.3
AA seq 417 aa AA seqDB search
MAGPFSRLLSARPGLRLLALAGAGSLAAGFLLRPEPVRAASERRRLYPPSAEYPDLRKHN
NCMASHLTPAVYARLCDKTTPTGWTLDQCIQTGVDNPGHPFIKTVGMVAGDEETYEVFAD
LFDPVIQERHNGYDPRTMKHTTDLDASKIRSGYFDERYVLSSRVRTGRSIRGLSLPPACT
RAERREVERVVVDALSGLKGDLAGRYYRLSEMTEAEQQQLIDDHFLFDKPVSPLLTAAGM
ARDWPDARGIWHNNEKSFLIWVNEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQER
GWEFMWNERLGYILTCPSNLGTGLRAGVHIKLPLLSKDSRFPKILENLRLQKRGTGGVDT
AATGGVFDISNLDRLGKSEVELVQLVIDGVNYLIDCERRLERGQDIRIPTPVIHTKH
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggctggtcccttctcccgtctgctgtccgcccgcccgggactcaggctcctggctttg
gccggagcggggtctctagccgctgggtttctgctccgaccggaacctgtacgagctgcc
agtgaacgacggaggctgtatcccccgagcgctgagtacccagacctccgaaagcacaac
aactgcatggccagtcacctgaccccagcagtctatgcacggctctgcgacaagaccaca
cccactggttggacgctagatcagtgtatccagactggcgtggacaaccctggccacccc
ttcatcaagactgtgggcatggtggctggagatgaggagacctatgaggtatttgctgac
ctgtttgaccctgtgatccaagagcgacacaatggatatgacccccggacaatgaagcac
accacggatctagatgccagtaaaatccgttctggctactttgatgagaggtatgtattg
tcctctagagtcagaactggccgaagcatccgaggactcagtctgcctccagcttgcact
cgagcagagcgacgagaggtggaacgtgttgtggtggatgcactgagtggcctgaagggt
gacctggctggacgttactataggctcagtgagatgacagaggctgaacagcagcagctt
attgatgaccactttctgtttgataagcctgtgtccccgttgctgactgcagcaggaatg
gctcgagactggccagatgctcgtggaatttggcacaacaatgagaagagcttcctgatc
tgggtgaatgaggaggatcatacacgggtgatctccatggagaagggtggtaacatgaag
agagtgtttgaaagattctgccgaggcctcaaagaggtggagagacttatccaagaacgt
ggctgggagttcatgtggaatgagcgtttgggatacatcttgacctgtccatctaacctg
ggcactggacttcgggcaggagtgcacatcaaactgcccctgctaagcaaagatagccgc
ttcccaaagatcctggagaacctaagactccaaaagcgtggtactggaggagtggacact
gctgccacaggcggtgtctttgatatttctaatttggaccgactaggcaaatcagaggtg
gagctggtgcaactggtcatcgatggagtaaactatttgattgattgtgaacggcgtctg
gagagaggccaggatatccgcatccccacacctgtcatccacaccaagcattaa

DBGET integrated database retrieval system