KEGG   Homo sapiens (human): 54870Help
Entry
54870             CDS       T01001                                 

Gene name
QRICH1, AB-DIP, VERBRAS
Definition
(RefSeq) glutamine rich 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF3504 CARD
Motif
Other DBs
NCBI-GeneID: 54870
NCBI-ProteinID: NP_001307509
OMIM: 617387
HGNC: 24713
Ensembl: ENSG00000198218
Vega: OTTHUMG00000156772
Pharos: Q2TAL8(Tdark)
UniProt: Q2TAL8 A1L3Z9
Position
3p21.31
AA seq 776 aa AA seqDB search
MNNSLENTISFEEYIRVKARSVPQHRMKEFLDSLASKGPEALQEFQQTATTTMVYQQGGN
CIYTDSTEVAGSLLELACPVTTSVQPQTQQEQQIQVQQPQQVQVQVQVQQSPQQVSAQLS
PQLTVHQPTEQPIQVQVQIQGQAPQSAAPSIQTPSLQSPSPSQLQAAQIQVQHVQAAQQI
QAAEIPEEHIPHQQIQAQLVAGQSLAGGQQIQIQTVGALSPPPSQQGSPREGERRVGTAS
VLQPVKKRKVDMPITVSYAISGQPVATVLAIPQGQQQSYVSLRPDLLTVDSAHLYSATGT
ITSPTGETWTIPVYSAQPRGDPQQQSITHIAIPQEAYNAVHVSGSPTALAAVKLEDDKEK
MVGTTSVVKNSHEEVVQTLANSLFPAQFMNGNIHIPVAVQAVAGTYQNTAQTVHIWDPQQ
QPQQQTPQEQTPPPQQQQQQLQVTCSAQTVQVAEVEPQSQPQPSPELLLPNSLKPEEGLE
VWKNWAQTKNAELEKDAQNRLAPIGRRQLLRFQEDLISSAVAELNYGLCLMTREARNGEG
EPYDPDVLYYIFLCIQKYLFENGRVDDIFSDLYYVRFTEWLHEVLKDVQPRVTPLGYVLP
SHVTEEMLWECKQLGAHSPSTLLTTLMFFNTKYFLLKTVDQHMKLAFSKVLRQTKKNPSN
PKDKSTSIRYLKALGIHQTGQKVTDDMYAEQTENPENPLRCPIKLYDFYLFKCPQSVKGR
NDTFYLTPEPVVAPNSPIWYSVQPISREQMGQMLTRILVIREIQEAIAVANASTMH
NT seq 2331 nt NT seq  +upstreamnt  +downstreamnt
atgaataattccctagagaacaccatctcctttgaagagtacatccgagtaaaggcacgg
tctgtcccgcaacacaggatgaaggaatttctggactcactggcctctaaggggccagaa
gcccttcaggagttccagcagacagccaccactaccatggtgtaccaacagggtgggaac
tgcatatacacagacagcactgaagtggctgggtctttgcttgaacttgcctgtccagtc
accaccagtgttcagccacaaacccagcaagaacagcagatccaggttcagcagccgcag
caggttcaggtccaggtgcaggtacagcagtctccgcaacaggtctcggctcagctctcc
ccacaactcaccgttcaccagcctactgagcaacccatccaggtccaggtgcagatccaa
ggccaggcaccacagtcagcagccccctccattcagaccccgtctctgcagagtcccagt
ccctcgcagctgcaagcagctcagatccaggtgcagcacgtgcaagcagcccagcagatc
caggctgcagaaatcccggaggagcacatcccacatcagcaaatccaggctcagctggtg
gctggccagtctcttgctggtggtcagcagatccaaatccagaccgtgggtgccctttcc
ccaccaccatcccagcagggctcaccccgggaaggggagcggcgggttggcacggccagt
gtcctccaaccagtgaagaagcgcaaagtggacatgcccatcactgtgtcctacgccatc
tcagggcagccggtggccaccgtgctggccattccacagggccagcagcagagttatgtg
tctttgaggccagacttactgacagtagacagtgcccacctgtacagtgccactgggacc
attactagccctacaggagaaacctggaccatccctgtttattctgcccagccccggggg
gaccctcagcagcagagcattacccacattgccattccccaggaagcctacaacgcagtt
cacgtcagtggctcacccacagccctggcagctgttaagctggaggatgacaaggagaag
atggtgggcaccacatctgtagtgaaaaactcccatgaagaggtagtgcagacccttgca
aactctctctttccagcacagttcatgaatggcaacatccacattccagtggctgtgcag
gctgtggcaggcacgtaccagaatacggctcaaactgtccatatatgggacccccaacag
cagccgcagcagcaaactccccaggaacagacaccaccaccacagcagcagcagcagcaa
ctccaagttacttgttcagctcaaactgtccaggttgctgaagttgaaccacagtcacag
ccacagccttccccagaacttctgcttccaaattctttgaagccagaagaagggcttgaa
gtatggaaaaactgggcccagaccaagaatgctgaactagagaaggatgctcagaacaga
ttggcacccattgggaggcgccaactgctgcgattccaggaagatctcatctcctctgct
gtggcagagttgaattatgggctctgtctaatgacacgggaagctcgaaatggagaaggt
gaaccctatgacccagatgtgctctactatattttcctgtgtattcaaaagtatcttttt
gaaaatggaagggtagatgacattttctccgatctttattatgttcggttcacggagtgg
ctacatgaagttctgaaggatgttcagccccgggtcactccacttggctatgtcttgccc
agccacgtgactgaggagatgctatgggagtgcaagcagcttggggctcactccccctcc
accttgctgaccaccctcatgttctttaataccaagtacttcctattgaagacagtggac
cagcacatgaagctggccttctccaaggtcttgcgacagacaaagaagaacccctctaat
cccaaggataaaagcacgagtatccggtacttgaaggcccttggaatacaccagactggc
cagaaagttacagatgacatgtatgcagaacagacggaaaatccagagaatccattgaga
tgtcccatcaagctctatgatttctacctcttcaaatgcccccagagtgtgaaaggccgg
aatgacaccttttacctgacacctgagccagtggtggcccccaacagcccaatctggtac
tcagtccagcctatcagcagagagcagatgggacaaatgctgacgcggatcctggtgata
agagaaattcaggaggccatcgcagtggccaatgcaagcactatgcactga

DBGET integrated database retrieval system