KEGG   Homo sapiens (human): 54877
Entry
54877             CDS       T01001                                 

Gene name
ZCCHC2, C18orf49
Definition
(RefSeq) zinc finger CCHC-type containing 2
  KO
K22700  Zinc finger CCHC domain-containing protein 2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    54877 (ZCCHC2)
SSDB
Motif
Pfam: zf-CCHC
Other DBs
NCBI-GeneID: 54877
NCBI-ProteinID: NP_060212
HGNC: 22916
Ensembl: ENSG00000141664
Vega: OTTHUMG00000180165
Pharos: Q9C0B9(Tdark)
UniProt: Q9C0B9 Q9BRD4
Position
18q21.33
AA seq 1178 aa
MLRMKLPLKPTHPAEPPPEAEEPEADARPGAKAPSRRRRDCRPPPPPPPPAGPSRGPLPP
PPPPRGLGPPVAGGAAAGAGMPGGGGGPSAALREQERVYEWFGLVLGSAQRLEFMCGLLD
LCNPLELRFLGSCLEDLARKDYHYLRDSEAKANGLSDPGPLADFREPAVRSRLIVYLALL
GSENREAAGRLHRLLPQVDSVLKSLRAARGEGSRGGAEDERGEDGDGEQDAEKDGSGPEG
GIVEPRVGGGLGSRAQEELLLLFTMASLHPAFSFHQRVTLREHLERLRAALRGGPEDAEV
EVEPCKFAGPRAQNNSAHGDYMQNNESSLIEQAPIPQDGLTVAPHRAQREAVHIEKIMLK
GVQRKRADKYWEYTFKVNWSDLSVTTVTKTHQELQEFLLKLPKELSSETFDKTILRALNQ
GSLKREERRHPDLEPILRQLFSSSSQAFLQSQKVHSFFQSISSDSLHSINNLQSSLKTSK
ILEHLKEDSSEASSQEEDVLQHAIIHKKHTGKSPIVNNIGTSCSPLDGLTMQYSEQNGIV
DWRKQSCTTIQHPEHCVTSADQHSAEKRSLSSINKKKGKPQTEKEKIKKTDNRLNSRING
IRLSTPQHAHGGTVKDVNLDIGSGHDTCGETSSESYSSPSSPRHDGRESFESEEEKDRDT
DSNSEDSGNPSTTRFTGYGSVNQTVTVKPPVQIASLGNENGNLLEDPLNSPKYQHISFMP
TLHCVMHNGAQKSEVVVPAPKPADGKTIGMLVPSPVAISAIRESANSTPVGILGPTACTG
ESEKHLELLASPLPIPSTFLPHSSTPALHLTVQRLKLPPPQGSSESCTVNIPQQPPGSLS
IASPNTAFIPIHNPGSFPGSPVATTDPITKSASQVVGLNQMVPQIEGNTGTVPQPTNVKV
VLPAAGLSAAQPPASYPLPGSPLAAGVLPSQNSSVLSTAATSPQPASAGISQAQATVPPA
VPTHTPGPAPSPSPALTHSTAQSDSTSYISAVGNTNANGTVVPPQQMGSGPCGSCGRRCS
CGTNGNLQLNSYYYPNPMPGPMYRVPSFFTLPSICNGSYLNQAHQSNGNQLPFFLPQTPY
ANGLVHDPVMGSQANYGMQQMAGFGRFYPVYPAPNVVANTSGSGPKKNGNVSCYNCGVSG
HYAQDCKQSSMEANQQGTYRLRYAPPLPPSNDTLDSAD
NT seq 3537 nt   +upstreamnt  +downstreamnt
atgctgaggatgaagctgccgctgaagccaacgcaccccgcggagccgccgcccgaggcg
gaggagcccgaggcggacgcgcggccgggcgcgaaggcgccttcgcgccgccgccgcgac
tgccgccccccgccgccgccgccgccgcccgcgggcccgtcgcggggccctctgccgccg
ccgccgccgccccggggactcgggccgcctgttgctggtggagcggcggcgggggcgggt
atgccgggcggcggcggggggccctcggcggcgctgcgcgagcaggagcgggtatacgag
tggttcgggctggtgctgggctcggcgcagcgcctggagttcatgtgcgggctgctggac
ctgtgcaacccgctggagctgcgcttccttggctcgtgcctggaggacctggcgcgcaag
gactaccactacctgcgcgactcggaggccaaggccaacggcctctcggacccggggccg
ctggccgacttccgagagcccgcggtgcgctcgcgcctcatcgtctacctggcgctgctg
ggctcggagaaccgggaggccgctggccgtctgcaccgcctgctaccccaggtggactcg
gtgctcaaaagcctgcgcgcggcccggggcgagggctcgcggggcggcgcggaggacgag
cgcggcgaggacggcgacggcgagcaggacgccgagaaggacggctcaggcccggaaggc
ggcattgtggagccccgggtcggcggcgggcttggctccagggcccaggaggaactgctg
ctgctcttcaccatggcctcgctgcacccggctttctccttccaccagcgggtcaccctg
agggaacacttggagaggctccgcgccgcgctccgcgggggccccgaggacgcggaggtg
gaggtagagccgtgcaagtttgccggccccagggcccagaacaactctgctcatggtgat
tacatgcaaaataacgagagcagcttaatagagcaagctccaatacctcaggacggactt
accgtggcacctcacagagctcagcgagaagctgtacacattgagaagataatgttgaaa
ggagtccagagaaaaagagctgacaaatactgggagtacactttcaaagtaaattggtct
gatctttcagtcacaacagtaacaaaaacccaccaagaactacaggaatttctactgaag
cttccaaaggaactgtcttcagagacttttgacaagaccatcttaagagccctgaatcag
ggttccttgaaaagggaggaacggcgacatcctgacctagagcccatcctaaggcagcta
ttttcaagttcatcacaagcttttctacaaagtcagaaagtacacagcttctttcagtcc
atatcatcagactccctacacagtatcaataacttacaatcctctctgaagacttctaag
atattagaacacttaaaagaagacagctctgaagcttcaagtcaagaagaagatgtgttg
cagcatgccataatccacaagaagcatactgggaaaagtcccattgtgaacaatattggt
acaagttgttctccattggatgggcttaccatgcaatattctgaacagaatggaattgtg
gattggaggaagcaaagctgtaccaccattcaacacccagagcactgtgtgacctcggct
gaccagcattctgctgaaaaacggagtttatcttcaataaataagaagaaaggaaagcca
caaacagaaaaggagaaaattaagaaaactgacaacagattgaatagtagaataaatggt
attagactctccactcctcagcatgcccatggtggtactgtgaaagatgtgaatttggac
attggctctggacatgacacatgtggagaaacatcttcagagagttacagttctccatct
agtccccgacatgatggaagagaaagttttgaaagtgaagaagagaaagacagagacaca
gacagcaattctgaggattctgggaatccatcaacaactaggtttacaggttacggttct
gtcaaccagactgtcactgtcaagccacctgttcaaattgcttcactaggaaatgagaat
ggaaaccttttagaagatcccttaaactcacccaagtatcagcatatttcttttatgcca
acgttacactgtgtcatgcacaatggtgcccagaagtctgaagttgtcgttcctgcaccc
aaacccgctgatggcaaaaccatagggatgcttgttcctagtcctgttgctatttctgca
ataagggagtctgcaaattcaacccctgttggaatactagggccaacagcttgcactgga
gaatcggaaaagcaccttgagttactggcttcccctttacctattccatcaaccttcctt
ccacacagtagtactcccgctttgcatcttacagttcagaggctaaagttgccaccacca
cagggatcttctgagagctgcacagttaacatcccacaacaaccacccggaagcctgagc
atcgcatcaccaaacactgcctttattcctatccataacccaggtagtttcccaggctct
cctgttgctaccacggaccccatcacaaaatctgcatcccaagtggtaggactcaatcaa
atggtgcctcaaattgagggaaacacagggacagtccctcagcctaccaatgtgaaggta
gttcttccagcagctggcctctcagctgctcagccaccagcttcctaccccttaccaggc
tctccccttgctgccggcgtgttacccagccagaactccagtgtgctcagcacagcagca
acttctccccagccagcgagcgcaggtatcagccaggcccaggcaactgttcctcctgca
gttcctacccacaccccaggccctgccccgagcccaagccctgccttgacacacagtacc
gcgcagagtgacagcacctcttacatcagtgctgtggggaacacgaacgctaatgggaca
gtagtgccaccgcagcagatgggctcaggtccttgtggttcttgtgggcgaaggtgcagc
tgtgggaccaatggaaaccttcagctaaatagttactattatcctaatccaatgcctgga
ccaatgtaccgagtcccttcattctttactctgccatccatttgcaatggcagctacctc
aaccaagcacatcagagcaatggaaaccaacttcctttttttctgcctcagactccatat
gcaaatggactggtacatgacccagtcatggggagccaagccaactatggcatgcagcag
atggcaggatttgggagattctatcctgtatatccagcacctaacgtagttgccaacacc
agtggttcggggcccaagaagaatgggaatgtctcatgttacaattgtggtgtaagcgga
cactatgcacaggactgtaagcagtcgtccatggaggccaatcaacaaggcacttacaga
ctgagatacgcacctcccctccccccttctaatgatacgttggattctgcagactga

DBGET integrated database retrieval system