KEGG   Homo sapiens (human): 54884Help
Entry
54884             CDS       T01001                                 

Gene name
RETSAT
Definition
(RefSeq) retinol saturase
  KO
K09516  all-trans-retinol 13,14-reductase [EC:1.3.99.23]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    54884 (RETSAT)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.99  With unknown physiological acceptors
    1.3.99.23  all-trans-retinol 13,14-reductase
     54884 (RETSAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_8 Amino_oxidase FAD_binding_2 FAD_oxidored DAO Thi4 FAD_binding_3 Pyr_redox_2 HI0933_like GIDA Pyr_redox AlaDh_PNT_C MCRA Lycopene_cycl GMC_oxred_N Pyr_redox_3
Motif
Other DBs
NCBI-GeneID: 54884
NCBI-ProteinID: NP_060220
OMIM: 617597
HGNC: 25991
Ensembl: ENSG00000042445
Vega: OTTHUMG00000154611
Pharos: Q6NUM9(Tdark)
UniProt: Q6NUM9
Position
2p11.2
AA seq 610 aa AA seqDB search
MWLPLVLLLAVLLLAVLCKVYLGLFSGSSPNPFSEDVKRPPAPLVTDKEARKKVLKQAFS
ANQVPEKLDVVVIGSGFGGLAAAAILAKAGKRVLVLEQHTKAGGCCHTFGKNGLEFDTGI
HYIGRMEEGSIGRFILDQITEGQLDWAPLSSPFDIMVLEGPNGRKEYPMYSGEKAYIQGL
KEKFPQEEAIIDKYIKLVKVVSSGAPHAILLKFLPLPVVQLLDRCGLLTRFSPFLQASTQ
SLAEVLQQLGASSELQAVLSYIFPTYGVTPNHSAFSMHALLVNHYMKGGFYPRGGSSEIA
FHTIPVIQRAGGAVLTKATVQSVLLDSAGKACGVSVKKGHELVNIYCPIVVSNAGLFNTY
EHLLPGNARCLPGVKQQLGTVRPGLGMTSVFICLRGTKEDLHLPSTNYYVYYDTDMDQAM
ERYVSMPREEAAEHIPLLFFAFPSAKDPTWEDRFPGRSTMIMLIPTAYEWFEEWQAELKG
KRGSDYETFKNSFVEASMSVVLKLFPQLEGKVESVTAGSPLTNQFYLAAPRGACYGADHD
LGRLHPCVMASLRAQSPIPNLYLTGQDIFTCGLVGALQGALLCSSAILKRNLYSDLKNLD
SRIRAQKKKN
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgtggcttccgctggtgctgctcctggctgtgctgctgctggccgtcctctgcaaagtt
tacttgggactattctctggcagctccccgaatcctttctccgaagatgtcaaacggccc
ccagcgcccctggtaactgacaaggaggccaggaagaaggttctcaaacaagctttttca
gccaaccaagtgccggagaagctggatgtggtggtaattggcagtggctttgggggcctg
gctgcagctgcaattctagctaaagctggcaagcgagtcctggtgctggaacaacatacc
aaggcagggggctgctgtcatacctttggaaagaatggccttgaatttgacacaggaatc
cattacattgggcgtatggaagagggcagcattggccgttttatcttggaccagatcact
gaagggcagctggactgggctcccctgtcctctccttttgacatcatggtactggaaggg
cccaatggccgaaaggagtaccccatgtacagtggagagaaagcctacattcagggcctc
aaggagaagtttccacaggaggaagctatcattgacaagtatataaagctggttaaggtg
gtatccagtggagcccctcatgccatcctgttgaaattcctcccattgcccgtggttcag
ctcctcgacaggtgtgggctgctgactcgtttctctccattccttcaagcatccacccag
agcctggctgaggtcctgcagcagctgggggcctcctctgagctccaggcagtactcagc
tacatcttccccacttacggtgtcacccccaaccacagtgccttttccatgcacgccctg
ctggtcaaccactacatgaaaggaggcttttatccccgagggggttccagtgaaattgcc
ttccacaccatccctgtgattcagcgggctgggggcgctgtcctcacaaaggccactgtg
cagagtgtgttgctggactcagctgggaaagcctgtggtgtcagtgtgaagaaggggcat
gagctggtgaacatctattgccccatcgtggtctccaacgcaggactgttcaacacctat
gaacacctactgccggggaacgcccgctgcctgccaggtgtgaagcagcaactggggacg
gtgcggcccggcttaggcatgacctctgttttcatctgcctgcgaggcaccaaggaagac
ctgcatctgccgtccaccaactactatgtttactatgacacggacatggaccaggcgatg
gagcgctacgtctccatgcccagggaagaggctgcggaacacatccctcttctcttcttc
gctttcccatcagccaaagatccgacctgggaggaccgattcccaggccggtccaccatg
atcatgctcatacccactgcctacgagtggtttgaggagtggcaggcggagctgaaggga
aagcggggcagtgactatgagaccttcaaaaactcctttgtggaagcctctatgtcagtg
gtcctgaaactgttcccacagctggaggggaaggtggagagtgtgactgcaggatcccca
ctcaccaaccagttctatctggctgctccccgaggtgcctgctacggggctgaccatgac
ctgggccgcctgcacccttgtgtgatggcctccttgagggcccagagccccatccccaac
ctctatctgacaggccaggatatcttcacctgtggactggtcggggccctgcaaggtgcc
ctgctgtgcagcagcgccatcctgaagcggaacttgtactcagaccttaagaatcttgat
tctaggatccgggcacagaagaaaaagaattag

DBGET integrated database retrieval system