KEGG   Homo sapiens (human): 54893Help
Entry
54893             CDS       T01001                                 

Gene name
MTMR10
Definition
(RefSeq) myotubularin related protein 10
  KO
K18085  myotubularin-related protein 10/11/12
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    54893 (MTMR10)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    54893 (MTMR10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related 3-PAP
Motif
Other DBs
NCBI-GeneID: 54893
NCBI-ProteinID: NP_060232
HGNC: 25999
Ensembl: ENSG00000166912
Vega: OTTHUMG00000175662
Pharos: Q9NXD2(Tdark)
UniProt: Q9NXD2 X5D963
Position
15q13.3
AA seq 777 aa AA seqDB search
MFSLKPPKPTFRSYLLPPPQTDDKINSEPKIKKLEPVLLPGEIVVNEVNFVRKCIATDTS
QYDLWGKLICSNFKISFITDDPMPLQKFHYRNLLLGEHDVPLTCIEQIVTVNDHKRKQKV
LGPNQKLKFNPTELIIYCKDFRIVRFRFDESGPESAKKVCLAIAHYSQPTDLQLLFAFEY
VGKKYHNSANKINGIPSGDGGGGGGGGNGAGGGSSQKTPLFETYSDWDREIKRTGASGWR
VCSINEGYMISTCLPEYIVVPSSLADQDLKIFSHSFVGRRMPLWCWSHSNGSALVRMALI
KDVLQQRKIDQRICNAITKSHPQRSDVYKSDLDKTLPNIQEVQAAFVKLKQLCVNEPFEE
TEEKWLSSLENTRWLEYVRAFLKHSAELVYMLESKHLSVVLQEEEGRDLSCCVASLVQVM
LDPYFRTITGFQSLIQKEWVMAGYQFLDRCNHLKRSEKESPLFLLFLDATWQLLEQYPAA
FEFSETYLAVLYDSTRISLFGTFLFNSPHQRVKQSTEFAISKNIQLGDEKGLKFPSVWDW
SLQFTAKDRTLFHNPFYIGKSTPCIQNGSVKSFKRTKKSYSSTLRGMPSALKNGIISDQE
LLPRRNSLILKPKPDPAQQTDSQNSDTEQYFREWFSKPANLHGVILPRVSGTHIKLWKLC
YFRWVPEAQISLGGSITAFHKLSLLADEVDVLSRMLRQQRSGPLEACYGELGQSRMYFNA
SGPHHTDTSGTPEFLSSSFPFSPVGNLCRRSILGTPLSKFLSGAKIWLSTETLANED
NT seq 2334 nt NT seq  +upstreamnt  +downstreamnt
atgttctccctcaagccgcccaaacccaccttcaggtcctacctcctgccaccgccccag
actgacgataagatcaattcggaaccgaagattaaaaaactggagccagtccttttgcca
ggagaaattgtcgtaaatgaagtcaattttgtgagaaaatgcattgcaacagacacaagc
cagtacgatttgtggggaaagctgatatgcagtaacttcaaaatctcctttattacagat
gacccaatgccattacagaaattccattacagaaaccttcttcttggtgaacacgatgtc
cctttaacatgtattgagcaaattgtcacagtaaacgaccacaagaggaagcagaaagtc
ctaggccccaaccagaaactgaaatttaatccaacagagttaattatttattgtaaagat
ttcagaattgtcagatttcgctttgatgaatcaggtcccgaaagtgctaaaaaggtatgc
cttgcaatagctcattattcccagccaacagacctccagctactctttgcatttgaatat
gttgggaaaaaataccacaattcagcaaacaaaattaatggaattccctcaggagatgga
ggaggaggaggaggaggaggtaatggagctggtggtggcagcagccagaaaactccactc
tttgaaacttactcggattgggacagagaaatcaagaggacaggtgcttccgggtggaga
gtttgttctattaacgagggttacatgatatccacttgccttccagaatacattgtagtg
ccaagttctttagcagaccaagatctaaagatcttttcccattcttttgttgggagaagg
atgccactctggtgctggagccactctaacggcagtgctcttgtgcgaatggccctcatc
aaagacgtgctgcagcagaggaagattgaccagaggatttgtaatgcaataactaaaagt
cacccacagagaagtgatgtttacaaatcagatttggataagaccttgcctaatattcaa
gaagtacaggcagcatttgtaaaactgaagcagctatgcgttaatgagccttttgaagaa
actgaagagaaatggttatcttcactggaaaatactcgatggttagaatatgtaagggca
ttccttaagcattcagcagaacttgtatacatgctagaaagcaaacatctctctgtagtc
ctacaagaggaggaaggaagagacttgagctgttgtgtagcttctcttgttcaagtgatg
ctggatccctattttaggacaattactggatttcagagtctgatacagaaggagtgggtc
atggcaggatatcagtttctagacagatgcaaccatctaaagagatcagagaaagagtct
cctttatttttgctattcttggatgccacctggcagctgttagaacaatatcctgcagct
tttgagttctccgaaacctacctggcagtgttgtatgacagcacccggatctcactgttt
ggcaccttcctgttcaactcccctcaccagcgagtgaagcaaagcacggaatttgctata
agcaaaaacatccaattgggtgatgagaagggcttaaaattcccctctgtttgggactgg
tctctccagtttacagcaaaggatcgcacccttttccataaccccttctacattggaaag
agcacaccttgtatacagaatggctccgtgaagtcttttaaacggacaaagaaaagctac
agctccacactaagaggaatgccgtctgccttaaagaatggaatcatcagtgaccaagaa
ttacttccaaggagaaattcattgatattaaaaccaaagccagatccagctcagcaaacc
gacagccagaacagtgatacggagcagtattttagagaatggttttccaaacccgccaac
ctgcacggtgttattctgccacgtgtctctggaacacacataaaactgtggaaactgtgc
tacttccgctgggttcccgaggcccagatcagcctgggtggctccatcacagcctttcac
aagctctccctcctggctgatgaagtcgacgtactgagcaggatgctgcggcaacagcgc
agtggccccctggaggcctgctatggggagctgggccagagcaggatgtacttcaacgcc
agcggccctcaccacaccgacacctcggggacaccggagtttctctcctcctcatttcca
ttttctcctgtagggaatctgtgcagacgaagcattttaggaacaccattaagcaaattt
ttaagtggggccaaaatatggttgtctactgagacattagcaaatgaagactaa

DBGET integrated database retrieval system