KEGG   Homo sapiens (human): 54896
Entry
54896             CDS       T01001                                 

Gene name
SLC66A1, LAAT-1, LAAT1, PQLC2
Definition
(RefSeq) solute carrier family 66 member 1
  KO
K23678  solute carrier family 66 (lysosomal lysine-arginine transporter), member 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    54896 (SLC66A1)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC66: Lysosomal lysine-arginine transporter
   54896 (SLC66A1)
SSDB
Motif
Pfam: PQ-loop PAP2_3 MtN3_slv TauE DUF3021
Other DBs
NCBI-GeneID: 54896
NCBI-ProteinID: NP_001035214
OMIM: 614760
HGNC: 26001
Ensembl: ENSG00000040487
Vega: OTTHUMG00000002521
Pharos: Q6ZP29(Tdark)
UniProt: Q6ZP29 A0A024RAE3
Position
1p36.13
AA seq 291 aa
MVWKKLGSRNFSSCPSGSIQWIWDVLGECAQDGWDEASVGLGLISILCFAASTFPQFIKA
YKTGNMDQALSLWFLLGWIGGDSCNLIGSFLADQLPLQTYTAVYYVLADLVMLTLYFYYK
FRTRPSLLSAPINSVLLFLMGMACATPLLSAAGPVAAPREAFRGRALLSVESGSKPFTRQ
EVIGFVIGSISSVLYLLSRLPQIRTNFLRKSTQGISYSLFALVMLGNTLYGLSVLLKNPE
EGQSEGSYLLHHLPWLVGSLGVLLLDTIISIQFLVYRRSTAASELEPLLPS
NT seq 876 nt   +upstreamnt  +downstreamnt
atggtctggaagaaactgggctcccgcaacttctccagctgccccagtggctccatccag
tggatatgggatgtgttgggtgaatgtgcccaggacggctgggacgaggccagcgtgggc
ctgggcttgatctccattctctgctttgctgcatctaccttcccccagttcatcaaagcc
tacaagacgggcaacatggaccaggcgctgtccctgtggttcctcctgggctggattggc
ggagactcctgcaacctcatcggctccttccttgctgaccagctgcccctgcagacctac
acggctgtgtattatgtcttggcagacctggtgatgctgacgctgtacttttactacaag
ttcaggacgcgcccctctctgttgtctgcccccatcaactccgtgctgttgttcctcatg
gggatggcgtgcgccacaccgctgctgagtgctgctgggcccgtggctgcccctagggaa
gccttccgggggcgggcgctcctgtccgtggagtcgggcagcaagcccttcacccggcag
gaagtcattggcttcgtcatcggctccatctccagcgtgttgtacctgctttcccggctg
cctcagatccgcaccaacttcctccggaagtccacccaggggatctcctactctctgttc
gcgctggtgatgctggggaacacgctgtatgggctgagcgtgctgctcaaaaaccccgag
gagggccagagcgagggcagctacctgctgcaccacctgccctggcttgtgggcagcctg
ggcgtgctgctgctcgacaccatcatctccatccagttcctggtgtacaggcgcagcacc
gccgcctcggagcttgagcccctcctccccagctga

DBGET integrated database retrieval system