KEGG   Homo sapiens (human): 54897
Entry
54897             CDS       T01001                                 
Symbol
CASZ1, CAS11, CST, SRG, ZNF693, dJ734G22.1
Name
(RefSeq) castor zinc finger 1
  KO
K25209  zinc finger protein castor
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    54897 (CASZ1)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    54897 (CASZ1)
SSDB
Other DBs
NCBI-GeneID: 54897
NCBI-ProteinID: NP_001073312
OMIM: 609895
HGNC: 26002
Ensembl: ENSG00000130940
Pharos: Q86V15(Tbio)
UniProt: Q86V15 B3KRV8
Position
1:complement(10636604..10796646)
AA seq 1759 aa
MDLGTAEGTRCTDPPAGKPAMAPKRKGGLKLNAICAKLSRQVVVEKRADAGSHTEGSPSQ
PRDQERSGPESGAARAPRSEEDKRRAVIEKWVNGEYSEEPAPTPVLGRIAREGLELPPEG
VYMVQPQGCSDEEDHAEEPSKDGGALEEKDSDGAASKEDSGPSTRQASGEASSLRDYAAS
TMTEFLGMFGYDDQNTRDELARKISFEKLHAGSTPEAATSSMLPTSEDTLSKRARFSKYE
EYIRKLKAGEQLSWPAPSTKTEERVGKEVVGTLPGLRLPSSTAHLETKATILPLPSHSSV
QMQNLVARASKYDFFIQKLKTGENLRPQNGSTYKKPSKYDLENVKYLHLFKPGEGSPDMG
GAIAFKTGKVGRPSKYDVRGIQKPGPAKVPPTPSLAPAPLASVPSAPSAPGPGPEPPASL
SFNTPEYLKSTFSKTDSITTGTVSTVKNGLPTDKPAVTEDVNIYQKYIARFSGSQHCGHI
HCAYQYREHYHCLDPECNYQRFTSKQDVIRHYNMHKKRDNSLQHGFMRFSPLDDCSVYYH
GCHLNGKSTHYHCMQVGCNKVYTSTSDVMTHENFHKKNTQLINDGFQRFRATEDCGTADC
QFYGQKTTHFHCRRPGCTFTFKNKCDIEKHKSYHIKDDAYAKDGFKKFYKYEECKYEGCV
YSKATNHFHCIRAGCGFTFTSTSQMTSHKRKHERRHIRSSGALGLPPSLLGAKDTEHEES
SNDDLVDFSALSSKNSSLSASPTSQQSSASLAAATAATEAGPSATKPPNSKISGLLPQGL
PGSIPLALALSNSGLPTPTPYFPILAGRGSTSLPVGTPSLLGAVSSGSAASATPDTPTLV
ASGAGDSAPVAAASVPAPPASIMERISASKGLISPMMARLAAAALKPSATFDPGSGQQVT
PARFPPAQVKPEPGESTGAPGPHEASQDRSLDLTVKEPSNESNGHAVPANSSLLSSLMNK
MSQGNPGLGSLLNIKAEAEGSPAAEPSPFLGKAVKALVQEKLAEPWKVYLRRFGTKDFCD
GQCDFLHKAHFHCVVEECGALFSTLDGAIKHANFHFRTEGGAAKGNTEAAFPASAAETKP
PMAPSSPPVPPVTTATVSSLEGPAPSPASVPSTPTLLAWKQLASTIPQMPQIPASVPHLP
ASPLATTSLENAKPQVKPGFLQFQENDPCLATDCKYANKFHFHCLFGNCKYVCKTSGKAE
SHCLDHINPNNNLVNVRDQFAYYSLQCLCPNQHCEFRMRGHYHCLRTGCYFVTNITTKLP
WHIKKHEKAERRAANGFKYFTKREECGRLGCKYNQVNSHFHCIREGCQFSFLLKHQMTSH
ARKHMRRMLGKNFDRVPPSQGPPGLMDAETDECMDYTGCSPGAMSSESSTMDRSCSSTPV
GNESTAAGNTISMPTASGAKKRFWIIEDMSPFGKRRKTASSRKMLDEGMMLEGFRRFDLY
EDCKDAACQFSLKVTHYHCTRENCGYKFCGRTHMYKHAQHHDRVDNLVLDDFKRFKASLS
CHFADCPFSGTSTHFHCLRCRFRCTDSTKVTAHRKHHGKQDVISAAGFCQFSSSADCAVP
DCKYKLKCSHFHCTFPGCRHTVVGMSQMDSHKRKHEKQERGEPAAEGPAPGPPISLDGSL
SLGAEPGSLLFLQSAAAGLGLALGDAGDPGPPDAAAPGPREGAAAAAAAAGESSQEDEEE
ELELPEEEAEDDEDEDDDEDDDDEDDDEDDDDEDLRTDSEESLPEAAAEAAGAGARTPAL
AALAALGAPGPAPTAASSP
NT seq 5280 nt   +upstreamnt  +downstreamnt
atggatcttggaacagctgagggcacccggtgcacggacccgcctgcaggcaagcccgcc
atggcgcccaaacgcaagggtggcctgaagctgaacgccatctgcgccaagctgagccgc
caggtggtggtggagaagcgagctgacgccggctcccacacggagggcagcccatcgcag
ccccgggaccaagagcgcagtggccctgagtctggggcagcccgggccccccgcagcgag
gaagacaagagacgggcagtgatcgagaagtgggtgaacggggagtacagcgaggagccg
gcacccacacccgtgttggggcggattgcccgcgagggcctggagctgcctcccgagggt
gtctacatggtgcagccccaggggtgcagcgatgaggaagaccacgcggaggagccctcc
aaggacggcggtgccctggaggagaaggattcggacggggcagcctccaaggaggacagc
ggccccagcaccaggcaggcttcaggagaggcctcctcgctgcgggactacgcggcctcc
accatgaccgagttcctcggcatgtttggctatgatgaccagaacacgcgggacgagctg
gccaggaagatcagctttgagaagctgcacgcgggctccaccccggaggcagccacctcc
tccatgctgcccacctccgaggataccctcagcaagcgggcgcggttctctaagtatgag
gagtacatccgcaagctcaaggctggcgagcagctctcctggccggcccccagcaccaag
accgaggagcgggtgggcaaggaggtggtgggcaccctgcccggcctgcggctgcccagc
agcacggcccacctggagaccaaggccaccatcctgcccctgccgtcgcacagcagtgtc
cagatgcagaacctggtagcccgggcctccaagtacgacttcttcatccaaaaactgaag
accggcgagaatctgcggccccagaacgggagcacctacaagaagccatccaagtacgac
ctggagaatgtcaagtacctgcacctcttcaaacccggggagggcagccccgacatgggc
ggggccatcgccttcaagacaggcaaggtggggcgcccttccaagtacgacgtccggggc
atccagaagccaggccccgccaaggttccgcccacccccagcctggctcccgcacccctc
gccagcgtgcccagtgcccccagcgcccccgggccagggccagagcctcctgcctccctg
tccttcaacactcccgagtacctgaagtcaaccttctccaaaacagactccatcaccacg
gggaccgtctccactgtcaagaacggactgcccacagataaaccagccgtcactgaagat
gtaaacatttaccagaaatatattgccaggttctcgggcagccagcactgtggccacatc
cactgtgcctaccagtaccgcgagcactaccactgccttgaccctgagtgtaactaccag
aggttcacgagtaagcaggacgtgatccgccactacaacatgcacaagaagcgcgacaac
tccctgcagcacggcttcatgcgtttcagcccgctggacgactgcagcgtctactaccac
ggctgccacctcaatgggaagagcacccactatcactgcatgcaggtgggctgtaacaag
gtgtacacgagcacgtctgacgtgatgacccacgagaacttccacaagaagaatacccag
ctcattaacgacggcttccagcgcttccgagccaccgaagactgtggcacagccgactgc
cagttctacggacagaagaccacgcacttccactgcaggcgccccggctgcacattcact
ttcaagaacaagtgtgacatcgagaagcacaagagctaccacatcaaggacgatgcctac
gccaaggacggcttcaagaagttctacaagtacgaggagtgcaagtacgagggctgcgtg
tacagcaaggctaccaaccacttccactgcatccgcgccggctgcggcttcaccttcacc
tccaccagccagatgacctctcacaagcgcaagcatgagcgccggcacatccgctcctcg
ggcgcgctggggctgccgccctcgctgctgggcgccaaggacacggagcacgaggagtcc
agcaacgacgaccttgttgacttctccgccctgagcagcaagaactccagcctgagcgcc
tcccctaccagccagcagtcctctgcgtccctggctgccgccactgccgccaccgaggct
gggcccagtgccaccaaacctcccaacagcaagatctcggggctgctgccccagggcctg
cctggctcaatccccctggccctggccctctccaactcgggcctgcccacccccacgccc
tacttccccatactggctggccgtgggagcacctccctgcctgtgggcacccccagcctc
ctgggtgccgtgtcgtctgggtcagcagcctcagccacccctgacacacccacgctggtc
gcctcgggagctggagactcagcccccgtggctgccgcctctgtcccggcaccacccgcc
tccatcatggagaggatctctgcaagcaagggcctcatctcgcccatgatggccaggctg
gctgcagctgccctcaagccctctgccacctttgacccaggaagcgggcagcaggtcacc
ccagccaggttccccccggcccaagtgaagccggaacccggtgagagcaccggcgcccca
ggcccccacgaagcctcccaggaccgcagtctagacctgactgtgaaggagcccagcaac
gaatcaaatggccacgcagtcccggcaaattcatctcttttatcctcgcttatgaataag
atgtctcagggcaaccctggcctgggcagcctgctgaacatcaaggcggaagcggagggg
agccccgctgcggagccctcgcccttcctaggcaaggccgtgaaggcgctggttcaggag
aagttggcagagccctggaaggtgtacctgcgcaggtttggtacaaaggacttctgtgac
ggccagtgtgacttcctccacaaggcccacttccactgcgtggtggaggaatgcggcgcg
ctcttcagcaccttggacggggccatcaagcacgcaaacttccacttccggacagaggga
ggagcagcaaaaggaaacacagaggctgcctttccggcctcggccgccgagaccaaacct
cccatggccccctcgtcccctccggtccctcctgtcaccacggccacggtgtcctctctg
gaggggcccgctcccagcccggcctccgtgccctccacccccaccctgctcgcctggaag
cagctggcttccaccataccccagatgcctcagatcccagcgtcagtgcctcacctgccc
gcctcgcccttggcaacgacttctctagagaacgccaagccccaggtcaaacccggattc
ctccagttccaggagaacgatccttgcctcgccacggactgcaagtacgccaacaagttc
cacttccactgtctctttgggaactgcaagtacgtctgcaaaacgtctggcaaggccgaa
tcccactgcctggaccacatcaaccccaacaacaacctggtgaacgtgcgagaccagttt
gcatactactctctgcagtgtctctgtcccaaccagcactgcgagttccgaatgcgtggg
cactaccactgcctccgcaccggctgctattttgtgaccaacatcaccaccaagctcccc
tggcacatcaagaagcatgagaaggcggagcggcgggcagccaatggcttcaaatacttc
accaagcgcgaggagtgtggcaggctaggttgcaagtacaaccaggtgaacagccacttc
cactgcatccgggagggctgccagttctccttcctcctcaagcaccagatgacctcccac
gcgcggaagcacatgcggaggatgctggggaagaacttcgaccgcgtgcccccctcccag
ggccccccaggcctgatggatgctgagacagatgagtgcatggactacactggctgcagc
ccaggcgccatgtcctctgagtcatccaccatggaccggagctgctccagcacccccgtg
ggtaacgagagcaccgcggcagggaacaccatctctatgccgacagcctcgggggccaaa
aagcgcttctggatcatcgaggacatgtcgcccttcggcaagcggcggaagacggcgtcc
tcccggaagatgctggacgagggcatgatgctggagggcttccggcgcttcgacctttac
gaggactgcaaggacgcagcttgtcagttctcgctcaaggtcacccactaccactgcacg
cgcgagaactgcggctacaagttctgcgggcgcacgcacatgtacaagcacgcgcagcac
cacgaccgcgtggacaacctggtgctggacgacttcaagcgcttcaaggcctcactcagc
tgccacttcgccgactgccccttctcgggcaccagcacgcacttccactgcctgcgctgc
cgcttccgctgcaccgacagcaccaaggtcacggcgcatcgcaagcaccacggcaaacag
gacgtgatcagcgccgcgggcttctgccagttcagctccagcgccgactgcgccgtgccc
gactgcaagtacaagctcaagtgctcgcacttccactgcaccttcccgggctgccgccac
acggtggtgggcatgtcgcagatggactcgcacaagcgcaagcacgagaagcaggagcgc
ggcgagcccgcggcagagggccccgcgcccgggcctcccatcagtctggacggctccctg
tcgctgggcgccgagccgggctcgctgctcttcctgcagtcggcggccgccggcctgggc
ctggcgctgggcgacgcgggcgaccccggcccgcccgacgccgccgcccccgggccgcgc
gagggcgccgccgccgccgccgccgcagctggggagtcctcgcaggaggacgaggaggag
gagctggagctgccggaggaggaggccgaagacgacgaggacgaggacgacgacgaggac
gacgacgacgaggacgacgacgaggacgacgacgacgaggacctgcgcaccgactcggag
gagtcgctgcccgaggcggcggcggaggcggcgggcgcgggcgcgcggaccccggccttg
gcggcgctggcggccctgggcgcccccggccccgcgcccactgcagcctcctcgccctag

DBGET integrated database retrieval system