KEGG   Homo sapiens (human): 549Help
Entry
549               CDS       T01001                                 

Gene name
AUH
Definition
(RefSeq) AU RNA binding methylglutaconyl-CoA hydratase
  KO
K05607  methylglutaconyl-CoA hydratase [EC:4.2.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00280  Valine, leucine and isoleucine degradation
hsa01100  Metabolic pathways
Module
hsa_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
Disease
H00754  3-Methylglutaconic aciduria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    549 (AUH)
Enzymes [BR:hsa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.18  methylglutaconyl-CoA hydratase
     549 (AUH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-GeneID: 549
NCBI-ProteinID: NP_001689
OMIM: 600529
HGNC: 890
Ensembl: ENSG00000148090
Vega: OTTHUMG00000020207
Pharos: Q13825(Tbio)
UniProt: Q13825
Structure
PDB: 

Position
9q22.31
AA seq 339 aa AA seqDB search
MAAAVAAAPGALGSLHAGGARLVAACSAWLCPGLRLPGSLAGRRAGPAIWAQGWVPAAGG
PAPKRGYSSEMKTEDELRVRHLEEENRGIVVLGINRAYGKNSLSKNLIKMLSKAVDALKS
DKKVRTIIIRSEVPGIFCAGADLKERAKMSSSEVGPFVSKIRAVINDIANLPVPTIAAID
GLALGGGLELALACDIRVAASSAKMGLVETKLAIIPGGGGTQRLPRAIGMSLAKELIFSA
RVLDGKEAKAVGLISHVLEQNQEGDAAYRKALDLAREFLPQGPVAMRVAKLAINQGMEVD
LVTGLAIEEACYAQTIPTKDRLEGLLAFKEKRPPRYKGE
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgcggtggcggcggcacctggggccttgggatccctgcatgctggcggcgcc
cgcctggtggccgcttgcagtgcgtggctctgcccggggttgaggctgcccggctcgttg
gcaggccggcgagcgggcccggcgatctgggcccagggctgggtacctgcggccgggggt
cccgccccgaaaaggggctacagctctgagatgaagacggaggacgagctgcgggtgcgg
cacctggaggaggagaaccgaggaattgtggtgcttggaataaacagagcttatggcaaa
aattcactcagtaaaaatcttataaaaatgctatcaaaagctgtggatgctttgaaatct
gataagaaagtacggaccataataatcaggagtgaagtcccagggatattctgtgctggt
gctgaccttaaggaaagagccaaaatgagttccagtgaagttggtccttttgtctccaaa
ataagagcagtgattaacgatattgctaatcttccagtaccaacaattgcagcaatagat
ggactcgctttaggtggtggtcttgaactggctttagcctgtgatatacgagtagcagct
tcctctgcaaaaatgggcctggttgaaacaaaattggcgattattcctggtggagggggg
acacagcgattgccacgcgccattggaatgtccctggccaaggagctcatattctctgcg
cgagtcctcgatggcaaagaagccaaagcagtgggcttaatcagccacgttctggaacag
aaccaggagggagacgcggcctacaggaaggccttggacctggcgagagagtttttacct
cagggacctgttgcaatgagagtggcaaaattagcaattaatcaagggatggaggtcgat
ttagtaacagggttagccatagaagaagcttgttatgctcagaccattccaacaaaagac
agacttgaaggtcttcttgcttttaaagagaaaaggccccctcgctataaaggagaataa

DBGET integrated database retrieval system