KEGG   Homo sapiens (human): 54906
Entry
54906             CDS       T01001                                 

Gene name
TASOR2, C10orf18, FAM208B, bA318E3.2
Definition
(RefSeq) transcription activation suppressor family member 2
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: DUF3715 DUF3699
Other DBs
NCBI-GeneID: 54906
NCBI-ProteinID: NP_001308712
HGNC: 23484
Ensembl: ENSG00000108021
Vega: OTTHUMG00000017605
Pharos: Q5VWN6(Tdark)
UniProt: Q5VWN6
Position
10p15.1
AA seq 2430 aa
MAPPAHKSILERSENVLMSPWKGKLIVQDRMLCDIALWSTYGAMIPTQLPQELDFKYVMK
VSSLKKRLPEAAFRKQNYLEEKVCFQDLCFNLYEVELSNRQGENIDKLTECIKNKQLAII
KCLEDRGFFILLTSSALLSEPDFGGKQMGLHGLHLFRSPLSTGVKDLKVEDDISMKVIPI
LSTLNCALLETKKSLPEERIHPNTLVKRHFQELYKADRSPSLSVAPQDRMKDPTFLGKLP
SGFDLIPPAEKCPSESLTQLNSYFSDPSAYILEVSTALDLLAEHPQSPCVSDGICDAGFS
LVMTPDPEFLVSEAEVRKETETKKDSEEMLKAKKRVFPLSPASNLRVQPKRKASMPHMVQ
SKKVNLCRPFPKRTASRADNSSDSPTTLKLVKGQFPQKRKRGAEVLTAQFVQKTKLDRKN
QEAPISKDVPVPTNAKRARKQEKSPVKTVPRAKPPVKKSPQKQRVNIVKGNENPRNRKQL
QPVKGETASKLQSEISRGCQEDGISINSVQPENTTAAHNDLPENSIVNYDSQALNMLADL
ALSSATSSTPVSEARNLHCSSELPQNDVLLSKENSLRGTSDHEYHRGVKTQKGELLPNPS
SDRKSNSGSDLTVSQDEESLVPCSQAPAKAQSALTEEMLESSDASQSSSVSVEHSYALLL
TEHSKKHLQEREILSPLFPRNGTKSPEAATPVGKVMPFRHQPGLLLQQKPPDDPVVKPKD
RPPSARVKKSSCSRIVLSCDDSVKITFKCETEYAFSLDSKYTNNPLEKTVVRALHGPWNT
DLPDNVEEVKLLLHMWVALFYSNQNKIIRSSRKVVEHSNPAKYVSINSTLESCELREIEE
SLGLEKCSADSLLETNEISRAHAAEVSFRDPNCLLPFIKTPLTQGLELCVQNEQKKTFAR
ECDPDTQEDQNFICSYNNEVTGEEAKQESLETSNLVLSGIGSTQTNGPSVPSEEEIVQPL
DSTRVASYSGTVTQATFTRTYDGPGSQPVICQSSVYGTLENKVDILDAAVQTKTGTLQDL
IQHGSPINNECHPSLERKDDNMGCAVINPEPITLTFEKNAHVPIQTEGVNTADERTTFKK
ELIKQVSPAASLRHPVSTSENARTQGLRDIPSLVVAGQKGTKYLCASSVGGETLDKAVCS
LQKETPLPVSLPSDKTMVMEALSLAKSSSHLSPSEEVRCTQDFLSQTQSLLGLSSEGLLE
LTQVEVDSSSASTTLGRQCSLNCISSGCHTSGDSLELRKNHKNGPNTENMNLEAFDSVFI
KQTSLSVSREVSLELSEEDSDIDLALTISPPTSPREEMPAGEIEQFEEAPFSNLELQDVA
EEIGEPEEVALTESREVSSADNVSVYPSVSEEPVENKERKGDNLQPVTLILSKENCTLEI
AEEINVTSDFPFDSVIEEVSPASSPEPPVPVKETRPYQAVTPCILKLHGTQCEKSNQISQ
CESEDLGITEKENVFVGPTHPVGQDNFTQVQQMQVSAEMPLILTDHPGRTGRPTLPGKVT
EEIVSSEHDEGLSFSGKVQCYGRELNQPASAAKCTGDFSPSPEKLVKSGNPLQPVSIENR
NLDLKHLVLESSEPPFGPRNVIENKSLSDTLVSTTAPSGIVNVSVKQQTSPKSSQNHLFP
GDLKTDEGIYLQVKSLTAASVDGAYSTQGCMCSVVPTLCSSSDNATLTHYVRPINAEPVF
QAQEIPAGRMASLLKNGEPEAELHKETTGPGTAGPQSNTTSSLKGERKAIHTLQDVSTCE
TKELLNVGVSSLCAGPYQNTADTKENLSKEPLASFVSESFDTSVCGIATEHVEIENSGEG
LRAEAGSETLGRDGEVGVNSDMHYELSGDSDLDLLGDCRNPRLDLEDSYTLRGSYTRKKD
VPTDGYESSLNFHNNNQEDWGCSSWVPGMETSLPPGHWTAAVKKEEKCVPPYVQIRDLHG
ILRTYANFSITKELKDTMRTSHGLRRHPSFSANCGLPSSWTSTWQVADDLTQNTLDLEYL
RFAHKLKQTIKNGDSQHSASSANVFPKESPTQISIGAFPSTKISEAPFLHPAPRSRSPLL
VTVVESDPRPQGQPRRGYTASSLDSSSSWRERCSHNRDLRNSQRNHTVSFHLNKLKYNST
VKESRNDISLILNEYAEFNKVMKNSNQFIFQDKELNDVSGEATAQEMYLPFPGRSASYED
IIIDVCTNLHVKLRSVVKEACKSTFLFYLVETEDKSFFVRTKNLLRKGGHTEIEPQHFCQ
AFHRENDTLIIIIRNEDISSHLHQIPSLLKLKHFPSVIFAGVDSPGDVLDHTYQELFRAG
GFVISDDKILEAVTLVQLKEIIKILEKLNGNGRWKWLLHYRENKKLKEDERVDSTAHKKN
IMLKSFQSANIIELLHYHQCDSRSSTKAEILKCLLNLQIQHIDARFAVLLTDKPTIPREV
FENSGILVTDVNNFIENIEKIAAPFRSSYW
NT seq 7293 nt   +upstreamnt  +downstreamnt
atggcaccaccagctcataaaagcatacttgaacgcagtgaaaatgttctcatgtctcca
tggaaagggaaattaattgttcaagaccgtatgctatgtgatatagctctttggtccact
tacggtgcaatgattccaacacagctaccgcaggaactagattttaaatatgtaatgaaa
gtgtcttccttgaaaaaaagactaccagaggctgccttcagaaaacagaattacttggag
gagaaagtctgttttcaagatttgtgcttcaatttgtatgaggtagaactgtcaaacaga
caaggggaaaatatagataaattaacagaatgtattaaaaacaagcaattggcaatcatc
aaatgcttagaagatcgagggtttttcattttacttacatcatcagccttactatcagaa
ccagattttggaggcaagcagatgggtctgcatgggttacatttatttcgttcacccctg
tcaacaggggtgaaagatttgaaagttgaagatgacatctcaatgaaggtgatacctatt
ttatctacccttaattgtgccctgctagaaacaaagaaatcacttcctgaagaaagaatc
catccaaacacattagtaaagcgtcatttccaagaattgtacaaggcggacagaagccct
tcattgagtgttgctcctcaggatagaatgaaagaccctacattcttggggaaactgccc
agtggttttgacttgattcctccagctgaaaagtgcccttcagagtctttaactcagttg
aactcttatttttcagaccctagtgcttacattttggaagtgtctactgctttggacttg
ctagcagagcatcctcagtctccttgtgtttcagacggaatttgtgatgctggattttcc
ttagttatgactccagatcctgaatttcttgtctcagaggcagaagtgagaaaagaaact
gaaacaaaaaaggattctgaagaaatgttgaaagcaaagaagagagtttttccattgagt
ccagcgtcaaatctgagagtgcagcctaagaggaaggccagcatgccccacatggtgcag
agtaaaaaggtgaacttgtgccgcccctttcccaaaagaactgcttccagagcagacaac
agctcggactctccaacaactcttaagttagttaaaggacagtttcctcagaaaagaaaa
agaggtgcggaagtgctgactgcacagtttgtacagaaaaccaaattggataggaaaaac
caagaagctcctatttctaaagatgttccagtgccaacaaatgctaaaagggcaaggaaa
caagagaaatctccagtcaaaactgttccaagggctaagccacctgtgaagaaatctcca
caaaaacagagagtaaatatagtaaaaggcaatgagaaccccagaaacagaaagcagcta
caacctgtcaaaggagaaactgcttcaaagcttcaatcagaaatttcaagaggttgtcaa
gaagatgggattagcataaatagtgttcaaccagaaaataccacagcggctcacaatgat
cttcctgaaaactccatcgtcaactatgactcccaggccctaaatatgttagccgatcta
gcattaagctctgctacttcttccacaccagtatctgaggctagaaatcttcactgttcc
tctgaattgccacaaaatgatgttttgctctctaaagaaaattctttgcgaggtacatct
gaccatgaatatcatagaggagttaaaactcaaaaaggtgaattactacctaacccatct
tctgataggaagagtaattctggatcagacttaacagttagccaagatgaagaaagcttg
gttccttgtagtcaggcccctgctaaagcccagtcagcacttactgaggaaatgctagaa
tcttcagatgcaagccaaagctcttctgtttctgtggaacattcatatgccctgctcctt
acagaacattcaaagaaacatctacaggagagagagatactaagccctctgtttcccagg
aatgggacaaaaagccctgaagcagcaaccccagtggggaaagtcatgccatttcggcat
cagcccggccttttgcttcagcaaaagcctcctgacgaccccgtggtgaagcccaaggat
cgaccaccgtctgcccgtgtgaaaaaatcttcttgctctcgtatagtgcttagctgtgat
gactccgttaagatcactttcaaatgtgaaacagaatatgcattcagtttagacagcaaa
tataccaacaacccactggagaaaactgtagtaagagcattacatgggccctggaatact
gatttgcctgataatgtggaagaagtgaagcttttacttcatatgtgggtagctctgttt
tacagcaatcagaacaaaatcatacgatcttcccgaaaggttgtagaacacagcaaccca
gcaaaatatgtgtctataaatagcacgttagaatcttgtgagctccgtgaaattgaggag
tcccttggtttggaaaaatgttctgcagactctctgttggagactaacgaaatttccagg
gctcatgctgctgaagtatccttccgtgatcctaactgcttgcttcctttcattaaaaca
ccacttacccaaggcttggaactctgtgtacaaaatgaacagaaaaaaacttttgcaaga
gagtgtgatccagacacccaagaagaccagaatttcatctgttcttacaataatgaggta
actggggaagaagctaaacaagaatcattggagacttctaatcttgtgctttcgggtatt
ggaagtacacaaactaatggaccttctgttcctagtgaagaagaaattgttcagccactg
gatagcacaagagtggcttcttacagtggcactgttactcaagccacattcaccaggact
tacgatgggcctggcagtcagccagtgatatgtcagagctctgtgtacggcacccttgaa
aacaaagtggatattcttgatgcagcagtgcaaacaaaaacaggtactttacaggacctt
atccaacatggcagccccataaacaatgaatgtcacccttccttggaaagaaaggatgat
aatatggggtgtgcagtgattaacccggaaccaattactctcacctttgaaaaaaatgca
catgtaccaatacagacagaaggtgtaaatactgctgatgaacgtacaacctttaagaag
gagttgattaagcaagtatcacctgctgcaagccttagacatcctgtatccacctcggaa
aatgcacgaacacaaggcctgagggacattccctctctagtagttgcaggacagaagggc
actaagtacctttgtgcctcgtcagtaggtggagagacacttgataaagcagtgtgttca
ttacagaaggagacgccccttccagtctctctaccatctgataaaacaatggtcatggag
gcactatcattagctaaaagttctagtcatctatcacccagtgaagaagtgagatgcact
caggatttcctttcacagactcagagtctcctcggcctatcttcagaagggcttctagaa
ctgacacaggttgaagtggactcatcatcagcctctaccaccttgggaaggcagtgttca
cttaactgcatttcgtcaggatgccacacatcaggtgactctttagaactaaggaagaat
cacaagaatggtccaaacactgaaaatatgaatttggaagcgtttgattcagtatttatc
aaacaaacaagcctgtctgtgagtagagaggtcagcctagagttatcagaggaagattct
gacattgacttagctctaacaatatcaccacctacaagtcccagagaagaaatgccagct
ggtgaaatagagcaatttgaggaggccccattctcaaatttagaacttcaggatgtagct
gaggaaataggtgaaccggaagaggtggctctcacagaaagcagagaagtgagttctgct
gacaatgtgtcagtatatccctcagtgtcagaagaaccagtagaaaataaggagagaaag
ggggataatttacaaccagttactttaatactttctaaagaaaattgcacccttgagatt
gcagaggaaattaatgtgacctctgattttccctttgattctgtaattgaagaagtatca
ccagcgtctagtcctgaacctccagtaccagttaaagagacacgaccatatcaggctgtg
actccatgcattttaaaacttcatggtacacagtgtgagaagagcaaccaaatctcccaa
tgtgagtcagaagacttaggcataacagaaaaagaaaatgtttttgttggtcctacccat
ccagtggggcaagataactttacccaggtacaacaaatgcaggtctctgccgaaatgcct
ctaatattaactgatcatccaggaagaacaggtagaccaacccttcctggtaaagtaact
gaggaaattgtctcaagtgagcatgatgagggtttatctttctcaggaaaggtgcagtgc
tatggtagggagttaaaccagcctgcctcagctgccaaatgcacaggtgacttcagtcct
tctcctgaaaaactggtaaaatcaggaaatccattgcagccagttagtatagagaataga
aatttggacttaaaacatcttgtcttggagtccagtgaacctccatttggtcctagaaat
gttattgaaaataagtctttgtctgacacattggtttccacaactgcaccaagtggtata
gtgaatgtgtcagtaaaacagcagactagccctaaaagcagtcagaaccatctctttccc
ggtgatttgaaaacagatgaaggcatttatctgcaggtgaagtccttgacagctgcctcg
gttgatggagcttattctacacagggatgcatgtgctcagtggtccccacgctttgttct
tcctcagacaatgctacattaacccattatgtaagaccaataaatgcagagccagtgttt
caagcacaggaaataccagcaggcagaatggccagtttgcttaagaatggtgagcctgaa
gctgagttacataaagaaaccacaggtccaggcactgctggccctcagtccaacaccaca
tcttctctaaaaggtgaacgcaaagccatccacacgctgcaagatgtgtcaacatgtgaa
acaaaggagctattgaatgtcggggtttcctccctttgtgctggtccctaccaaaataca
gcagacaccaaggaaaacctcagtaaagagcctttggcctcctttgtttcagaatccttt
gatacttctgtttgtggaatagccacagagcacgtagaaattgagaacagtggggagggg
ctcagggctgaggctggttctgaaaccctaggcagagatggagaggtcggtgtgaattcc
gacatgcactatgaactctctggagattctgatctagacctgcttggtgattgtagaaat
cccagactggatttggaggattcttatactttaagaggtagttacaccaggaaaaaagat
gttcccacagatggctatgagtcgtcgttgaacttccacaacaacaaccaagaggactgg
ggctgctctagctgggttccaggcatggagacgagcctccctcccgggcactggactgct
gcggtaaagaaagaagagaagtgtgtgccgccttacgtccaaatccgagatctccacggg
atcctcaggacttacgccaacttctctataacaaaagaactcaaagataccatgagaact
tcacacggcctgaggaggcacccgagtttcagtgcaaactgtggcctgcccagctcctgg
acaagcacttggcaggtggcagacgacctcacccagaacactttagacctggagtatctg
cgttttgcacataaactaaaacagaccataaagaatggggattctcagcattctgcctcc
tctgccaatgtctttccaaaggagtcaccaacccagatctccattggtgctttcccttcg
acaaaaatctctgaggccccatttctgcatcctgcacctaggagcagaagcccccttctg
gtaacagttgtggagtcagatcccagaccacaggggcagcccaggagaggctacacagcc
agcagtctggacagctcttcctcttggagagagagatgtagtcataatagagatcttaga
aattctcaaagaaatcacactgtttcattccacctcaacaaactgaaatacaacagtact
gtgaaggaatctcggaatgatatttcacttattctcaatgagtatgctgaattcaacaag
gtgatgaagaatagcaaccaattcattttccaagacaaagagctaaatgatgtttctgga
gaagccactgctcaagagatgtatctgcctttcccaggacggtcagcctcctatgaagac
ataatcatagacgtgtgcaccaatttgcacgtcaaactaagaagtgttgtgaaagaggct
tgtaaaagtaccttcctgttctaccttgtcgaaacagaagacaaatcattctttgtaaga
acaaagaaccttctgaggaaaggaggccatacagaaattgaacctcagcacttctgtcaa
gctttccacagagagaatgatacactaatcatcatcatcagaaatgaagatatatcatca
catttgcatcagattccttctttgctgaagctgaagcatttccccagtgtcatctttgct
ggagtagacagccctggagatgttcttgatcacacctaccaagaactgtttcgtgcagga
ggctttgtgatatcagatgacaagatactagaagctgtaacattagttcaactgaaggaa
attatcaaaatcctggaaaaactaaatggaaatggaagatggaagtggttgcttcactac
agggaaaataaaaagctaaaagaagatgaaagagtggattcaactgcacataagaagaac
ataatgttgaagtcatttcagagtgcaaatatcattgaattgcttcattatcaccagtgt
gactctcgatcatcaacaaaagcagaaattctgaaatgtttgctaaacctgcaaattcag
catattgatgccaggtttgctgtcctcctaacagacaagcctactatccccagagaagtc
tttgaaaatagtggaatccttgttacagatgtaaataactttatagaaaacatagaaaaa
atagcagctccatttaggagtagctattggtga

DBGET integrated database retrieval system