KEGG   Homo sapiens (human): 54908
Entry
54908             CDS       T01001                                 

Gene name
SPDL1, CCDC99
Definition
(RefSeq) spindle apparatus coiled-coil protein 1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Pox_A_type_inc CT_C_D
Other DBs
NCBI-GeneID: 54908
NCBI-ProteinID: NP_001316570
OMIM: 616401
HGNC: 26010
Ensembl: ENSG00000040275
Vega: OTTHUMG00000130438
Pharos: Q96EA4(Tbio)
UniProt: Q96EA4
Position
5q35.1
AA seq 605 aa
MEADIITNLRCRLKEAEEERLKAAQYGLQLVESQNELQNQLDKCRNEMMTMTESYEQEKY
TLQREVELKSRMLESLSCECEAIKQQQKMHLEKLEEQLSRSHGQEVNELKTKIEKLKVEL
DEARLSEKQLKHQVDHQKELLSCKSEELRVMSERVQESMSSEMLALQIELTEMESMKTTL
KEEVNELQYRQEQLELLITNLMRQVDRLKEEKEEREKEAVSYYNALEKARVANQDLQVQL
DQALQQALDPNSKGNSLFAEVEDRRAAMERQLISMKVKYQSLKKQNVFNREQMQRMKLQI
ATLLQMKGSQTEFEQQERLLAMLEQKNGEIKHLLGEIRNLEKFKNLYDSMESKPSVDSGT
LEDNTYYTDLLQMKLDNLNKEIESTKGELSIQRMKALFESQRALDIERKLFANERCLQLS
ESENMKLRAKLDELKLKYEPEETVEVPVLKKRREVLPVDITTAKDACVNNSALGGEVYRL
PPQKEETQSCPNSLEDNNLQLEKSVSIYTPVVSLSPHKNLPVDMQLKKEKKCVKLIGVPA
DAEALSERSGNTPNSPRLAAESKLQTEVKEGKETSSKLEKETCKKLHPILYVSSKSTPET
QCPQQ
NT seq 1818 nt   +upstreamnt  +downstreamnt
atggaggcagatataatcacaaatcttcgatgcaggctcaaagaggctgaagaagagcga
ctaaaagctgcacagtatggtttacaactagtagagagtcaaaatgaattacagaatcaa
ttggataaatgtcgtaatgaaatgatgaccatgactgagagttatgaacaagaaaaatat
acccttcaaagagaagttgaactcaagagtcgaatgttagaaagtttgagctgcgaatgt
gaagctattaaacaacaacaaaaaatgcacctggagaaattggaagaacaactaagcaga
agccatggacaggaagtgaatgaactaaaaactaagatagaaaaactgaaagtggaatta
gatgaagccaggcttagtgaaaagcagctgaagcaccaagtagatcatcagaaggaactc
ctctcttgtaaatcagaggaactgcgcgtaatgtctgaacgtgtgcaggaaagcatgtct
tcagagatgctggctcttcaaattgagctgacagaaatggagagtatgaagaccaccctc
aaagaagaagtgaatgaactacaatacagacaagaacagctagaacttcttattactaac
ctaatgcgccaggtagaccggcttaaagaggaaaaagaggagcgagagaaagaagcagtt
tcttactataatgccctagagaaagctcgtgtagcaaatcaagatcttcaggtacagttg
gaccaggcactccagcaagccttggatcccaatagtaaaggcaactctttgtttgcagag
gtggaagatcgaagggcagcaatggaacgtcagctcatcagtatgaaagtcaagtatcag
tcactaaagaagcaaaatgtatttaacagagaacagatgcagagaatgaagttacaaatt
gccacgttgctacagatgaaagggtctcaaactgaatttgagcagcaggaacggttgctt
gccatgttggagcagaagaatggtgaaataaaacatcttttaggtgaaattagaaatctg
gagaaatttaagaatttatatgacagtatggaatctaagccttcagtcgactctggtact
ctggaagataacacctattatacagatttacttcagatgaagctggataacttaaacaaa
gaaattgaaagcactaaaggtgaattgtccatacagcgaatgaaagcattatttgagagc
cagcgggctctagatattgagcgaaaactttttgcaaatgaaagatgcctccagctttca
gaaagtgaaaatatgaaactgagagctaaactagatgaattgaaactaaaatatgaacct
gaagagacagttgaagtgcctgtactgaaaaagaggcgtgaggtgctccctgtggatata
accaccgctaaagatgcatgtgtcaacaacagtgctctcgggggagaagtttatcgatta
ccgcctcagaaagaggagacacagtcctgccctaacagtttagaagataacaacttgcaa
ttagaaaaatcagtttctatatacacaccagtagtcagtctctctcctcacaaaaatctg
cccgtggatatgcagctgaagaaggaaaagaaatgtgtgaaactcataggagttcccgct
gacgctgaggccttaagtgaaagaagtggaaacacccctaactctcccaggttagctgct
gaatcaaagcttcaaacagaagttaaagaaggaaaagaaacttcaagcaaattggaaaaa
gaaacttgtaagaaattacaccctattctatatgtgtcttctaaatctactccagagacc
cagtgccctcaacagtaa

DBGET integrated database retrieval system