KEGG   Homo sapiens (human): 54910
Entry
54910             CDS       T01001                                 
Symbol
SEMA4C, M-SEMA-F, SEMACL1, SEMAF, SEMAI
Name
(RefSeq) semaphorin 4C
  KO
K06521  semaphorin 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    54910 (SEMA4C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    54910 (SEMA4C)
CD molecules [BR:hsa04090]
 Proteins
  54910 (SEMA4C)
SSDB
Motif
Pfam: Sema PSI Ig_2 Ig_3 Sema4F_C I-set LapA_dom DUF6232
Other DBs
NCBI-GeneID: 54910
NCBI-ProteinID: NP_060259
OMIM: 604462
HGNC: 10731
Ensembl: ENSG00000168758
Pharos: Q9C0C4(Tbio)
UniProt: Q9C0C4
Structure
Position
2:complement(96859718..96870830)
AA seq 833 aa
MAPHWAVWLLAARLWGLGIGAEVWWNLVPRKTVSSGELATVVRRFSQTGIQDFLTLTLTE
PTGLLYVGAREALFAFSMEALELQGAISWEAPVEKKTECIQKGKNNQTECFNFIRFLQPY
NASHLYVCGTYAFQPKCTYVNMLTFTLEHGEFEDGKGKCPYDPAKGHAGLLVDGELYSAT
LNNFLGTEPIILRNMGPHHSMKTEYLAFWLNEPHFVGSAYVPESVGSFTGDDDKVYFFFR
ERAVESDCYAEQVVARVARVCKGDMGGARTLQRKWTTFLKARLACSAPNWQLYFNQLQAM
HTLQDTSWHNTTFFGVFQAQWGDMYLSAICEYQLEEIQRVFEGPYKEYHEEAQKWDRYTD
PVPSPRPGSCINNWHRRHGYTSSLELPDNILNFVKKHPLMEEQVGPRWSRPLLVKKGTNF
THLVADRVTGLDGATYTVLFIGTGDGWLLKAVSLGPWVHLIEELQLFDQEPMRSLVLSQS
KKLLFAGSRSQLVQLPVADCMKYRSCADCVLARDPYCAWSVNTSRCVAVGGHSGSLLIQH
VMTSDTSGICNLRGSKKVRPTPKNITVVAGTDLVLPCHLSSNLAHARWTFGGRDLPAEQP
GSFLYDARLQALVVMAAQPRHAGAYHCFSEEQGARLAAEGYLVAVVAGPSVTLEARAPLE
NLGLVWLAVVALGAVCLVLLLLVLSLRRRLREELEKGAKATERTLVYPLELPKEPTSPPF
RPCPEPDEKLWDPVGYYYSDGSLKIVPGHARCQPGGGPPSPPPGIPGQPLPSPTRLHLGG
GRNSNANGYVRLQLGGEDRGGLGHPLPELADELRRKLQQRQPLPDSNPEESSV
NT seq 2502 nt   +upstreamnt  +downstreamnt
atggccccacactgggctgtctggctgctggcagcaaggctgtggggcctgggcattggg
gctgaggtgtggtggaaccttgtgccgcgtaagacagtgtcttctggggagctggccacg
gtagtacggcggttctcccagaccggcatccaggacttcctgacactgacgctgacggag
cccactgggcttctgtacgtgggcgcccgagaggccctgtttgccttcagcatggaggcc
ctggagctgcaaggagcgatctcctgggaggcccccgtggagaagaagactgagtgtatc
cagaaagggaagaacaaccagaccgagtgcttcaacttcatccgcttcctgcagccctac
aatgcctcccacctgtacgtctgtggcacctacgccttccagcccaagtgcacctacgtc
aacatgctcaccttcactttggagcatggagagtttgaagatgggaagggcaagtgtccc
tatgacccagctaagggccatgctggccttcttgtggatggtgagctgtactcggccaca
ctcaacaacttcctgggcacggaacccattatcctgcgtaacatggggccccaccactcc
atgaagacagagtacctggccttttggctcaacgaacctcactttgtaggctctgcctat
gtacctgagagtgtgggcagcttcacgggggacgacgacaaggtctacttcttcttcagg
gagcgggcagtggagtccgactgctatgccgagcaggtggtggctcgtgtggcccgtgtc
tgcaagggcgatatggggggcgcacggaccctgcagaggaagtggaccacgttcctgaag
gcgcggctggcatgctctgccccgaactggcagctctacttcaaccagctgcaggcgatg
cacaccctgcaggacacctcctggcacaacaccaccttctttggggtttttcaagcacag
tggggtgacatgtacctgtcggccatctgtgagtaccagttggaagagatccagcgggtg
tttgagggcccctataaggagtaccatgaggaagcccagaagtgggaccgctacactgac
cctgtacccagccctcggcctggctcgtgcattaacaactggcatcggcgccacggctac
accagctccctggagctacccgacaacatcctcaacttcgtcaagaagcacccgctgatg
gaggagcaggtggggcctcggtggagccgccccctgctcgtgaagaagggcaccaacttc
acccacctggtggccgaccgggttacaggacttgatggagccacctatacagtgctgttc
attggcacaggagacggctggctgctcaaggctgtgagcctggggccctgggttcacctg
attgaggagctgcagctgtttgaccaggagcccatgagaagcctggtgctatctcagagc
aagaagctgctctttgccggctcccgctctcagctggtgcagctgcccgtggccgactgc
atgaagtatcgctcctgtgcagactgtgtcctcgcccgggacccctattgcgcctggagc
gtcaacaccagccgctgtgtggccgtgggtggccactctggatctctactgatccagcat
gtgatgacctcggacacttcaggcatctgcaacctccgtggcagtaagaaagtcaggccc
actcccaaaaacatcacggtggtggcgggcacagacctggtgctgccctgccacctctcc
tccaacttggcccatgcccgctggacctttgggggccgggacctgcctgcggaacagccc
gggtccttcctctacgatgcccggctccaggccctggttgtgatggctgcccagccccgc
catgccggggcctaccactgcttttcagaggagcagggggcgcggctggctgctgaaggc
taccttgtggctgtcgtggcaggcccgtcggtgaccttggaggcccgggcccccctggaa
aacctggggctggtgtggctggcggtggtggccctgggggctgtgtgcctggtgctgctg
ctgctggtgctgtcattgcgccggcggctgcgggaagagctggagaaaggggccaaggct
actgagaggaccttggtgtaccccctggagctgcccaaggagcccaccagtccccccttc
cggccctgtcctgaaccagatgagaaactttgggatcctgtcggttactactattcagat
ggctcccttaagatagtacctgggcatgcccggtgccagcccggtggggggcccccttcg
ccacctccaggcatcccaggccagcctctgccttctccaactcggcttcacctggggggt
gggcggaactcaaatgccaatggttacgtgcgcttacaactaggaggggaggaccgggga
gggctcgggcaccccctgcctgagctcgcggatgaactgagacgcaaactgcagcaacgc
cagccactgcccgactccaaccccgaggagtcatcagtatga

DBGET integrated database retrieval system