KEGG   Homo sapiens (human): 54916
Entry
54916             CDS       T01001                                 
Symbol
TMEM260, C14orf101, SHDRA
Name
(RefSeq) transmembrane protein 260
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: DUF2723
Other DBs
NCBI-GeneID: 54916
NCBI-ProteinID: NP_060269
OMIM: 617449
HGNC: 20185
Ensembl: ENSG00000070269
Pharos: Q9NX78(Tdark)
UniProt: Q9NX78 B3KN73
Position
14:56579525..56663165
AA seq 707 aa
MSPHGDGRGQAQGRAVRVGLRRSGGIRGGVAVFAAVAAVFTFTLPPSVPGGDSGELITAA
HELGVAHPPGYPLFTLVAKLAITLFPFGSIAYRVNLLCGLFGAVAASLLFFTVFRLSGSS
AGGILAAGVFSFSRLTWQWSIAAEVFSLNNLFVGLLMALTVHFEEAATAKERSKVAKIGA
FCCGLSLCNQHTIILYVLCIIPWILFQLLKKKELSLGSLLKLSLYFSAGLLPYVHLPISS
YLNHARWTWGDQTTLQGFLTHFLREEYGTFSLAKSEIGSSMSEILLSQVTNMRTELSFNI
QALAVCANICLATKDRQNPSLVWLFTGMFCIYSLFFAWRANLDISKPLFMGVVERFWMQS
NAVVAVLAGIGLAAVVSETNRVLNSNGLQCLEWLSATLFVVYQIYSNYSVCDQRTNYVID
KFAKNLLTSMPHDAIILLRGDLPGNSLRYMHYCEGLRPDISLVDQEMMTYEWYLPKMAKH
LPGVNFPGNRWNPVEGILPSGMVTFNLYHFLEVNKQKETFVCIGIHEGDPTWKKNYSLWP
WGSCDKLVPLEIVFNPEEWIKLTKSIYNWTEEYGRFDPSSWESVANEEMWQARMKTPFFI
FNLAETAHMPSKVKAQLYAQAYDLYKEIVYLQKEHPVNWHKNYAIACERMLRLQARDADP
EVLLSETIRHFRLYSQKAPNDPQQADILGALKHLRKELQSLRNRKNV
NT seq 2124 nt   +upstreamnt  +downstreamnt
atgagtccccatggcgacggcaggggccaggcccaggggcgggcagtccgagtggggctg
cggcgctccgggggcatccgcggcggcgtggcggtgttcgccgccgtggccgcagtgttc
accttcaccctgcccccttcggtaccggggggagactccggggaactgatcacagccgca
catgagcttggagttgcccatcctcctggctatcctttgttcacgctggtggctaaactg
gcaattacactgtttccttttggttcaattgcctaccgcgtcaatcttctctgtggctta
tttggagcagtagctgcatcattactttttttcaccgttttcaggctttctggctcatct
gctggaggaatccttgctgcgggggtgttttcattttctcgtctaacatggcagtggtcc
attgcagcagaggtttttagcttaaacaatctctttgtggggctgcttatggctcttact
gtacattttgaggaagcagcaactgctaaggagagatcaaaggtagctaaaattggtgct
ttctgctgtggccttagtttatgtaaccagcacacaataatactctatgttttgtgcata
ataccttggattctctttcaacttttaaaaaagaaggaactctccctgggctctttgttg
aagttgagcctgtacttctctgctggtttgctgccctatgtccaccttcccatctcatct
taccttaatcacgcccggtggacctggggagaccagacaacactgcaaggatttttgaca
cattttctcagggaagaatatggaaccttcagcctggccaaatctgaaataggatccagt
atgtctgaaatactgctttctcaagtaacaaatatgaggaccgaactctcattcaacatc
caagcccttgcagtttgtgcaaatatatgtttagcaacaaaggacagacagaatccatca
ttagtatggctttttactggaatgttttgcatttattcattgttctttgcttggagagca
aatttagatatttcaaaaccacttttcatgggtgtggtggaacgattctggatgcagagc
aatgcagtagtggccgtcctcgctggcattggtttggctgcagttgtgtctgagactaac
cgagtgctgaatagcaatgggcttcagtgtctggaatggctttctgcaactctttttgta
gtttaccaaatatattctaattacagtgtttgtgaccaaaggaccaactatgtgattgat
aagttcgcaaagaaccttctcacctctatgcctcatgatgcaattatcttactcagagga
gatttgccaggaaattctctccgttacatgcattactgtgaggggttgaggcctgacatt
tcattagtggatcaggaaatgatgacttacgagtggtatttacccaagatggcaaagcac
ttgccaggtgtcaactttcctgggaaccggtggaatcctgtggaaggaatattacctagt
ggaatggtcacatttaatctttatcattttcttgaagtaaataaacaaaaagaaacattt
gtttgcataggaattcatgaaggcgacccaacctggaaaaagaactattcactttggcca
tgggggtcttgtgacaaattagttcctttggagattgtattcaaccctgaggaatggatt
aaacttacaaaaagtatctataactggaccgaagaatatggaaggtttgatccatcttct
tgggaatctgtggccaatgaagaaatgtggcaagcgaggatgaaaacaccgttcttcatc
tttaacctggcagaaactgctcacatgccttcaaaagtgaaagctcaactctacgctcaa
gcatatgacctttataaggagattgtctatttacaaaaggagcacccagtgaattggcac
aagaactatgccatcgcctgtgagcggatgctgcgtcttcaggcaagagatgcagatcct
gaagtgctgttatcggaaaccatcagacatttccgtctgtactctcagaaagcaccgaat
gacccacagcaagctgatattttaggtgctctaaagcacctaagaaaagaactgcaaagt
ctgagaaataggaaaaatgtctga

DBGET integrated database retrieval system