KEGG   Homo sapiens (human): 54918Help
Entry
54918             CDS       T01001                                 

Gene name
CMTM6, CKLFSF6, PRO2219
Definition
(RefSeq) CKLF like MARVEL transmembrane domain containing 6
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: MARVEL YrhK MFS_2 DUF4040
Motif
Other DBs
NCBI-GeneID: 54918
NCBI-ProteinID: NP_060271
OMIM: 607889
HGNC: 19177
Ensembl: ENSG00000091317
Vega: OTTHUMG00000130747
Pharos: Q9NX76(Tdark)
UniProt: Q9NX76
Position
3p22.3
AA seq 183 aa AA seqDB search
MENGAVYSPTTEEDPGPARGPRSGLAAYFFMGRLPLLRRVLKGLQLLLSLLAFICEEVVS
QCTLCGGLYFFEFVSCSAFLLSLLILIVYCTPFYERVDTTKVKSSDFYITLGTGCVFLLA
SIIFVSTHDRTSAEIAAIVFGFIASFMFLLDFITMLYEKRQESQLRKPENTTRAEALTEP
LNA
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atggagaacggagcggtgtacagccccactacggaggaggacccgggccccgccagaggc
ccccggagcggcctcgctgcctactttttcatgggccggctcccattgctccggcgcgtt
ctcaagggcttgcagctgttgctgtctctgctggccttcatctgtgaagaagttgtatca
caatgtactttatgtggaggactttatttttttgagtttgtaagctgcagtgcctttctt
ctgagtctccttatactgattgtgtattgcactccattttatgagagagttgataccaca
aaagtaaaatcatcggatttttatattactttgggaacaggatgtgtgtttttgttggca
tccatcatttttgtttccacacatgacaggacttcagctgagattgctgcaattgtgttt
ggatttatagcaagttttatgttcctacttgactttatcactatgctgtatgaaaaacga
caggagtcccagctgagaaaacctgaaaataccactagggctgaagccctcactgagcca
cttaatgcctaa

DBGET integrated database retrieval system