KEGG   Homo sapiens (human): 54921Help
Entry
54921             CDS       T01001                                 

Gene name
CHTF8, CTF8, DERPC
Definition
(RefSeq) chromosome transmission fidelity factor 8
  KO
K11270  chromosome transmission fidelity protein 8
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    54921 (CHTF8)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   CTF18-RFC complex
    54921 (CHTF8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ctf8
Motif
Other DBs
NCBI-GeneID: 54921
NCBI-ProteinID: NP_001034779
OMIM: 613202
HGNC: 24353
Ensembl: ENSG00000168802
Vega: OTTHUMG00000163909
Pharos: P0CG13(Tdark)
UniProt: P0CG13
Position
16q22.1
AA seq 121 aa AA seqDB search
MVQIVISSARAGGLAEWVLMELQGEIEARYSTGLAGNLLGDLHYTTEGIPVLIVGHHILY
GKIIHLEKPFAVLVKHTPGDQDCDELGRETGTRYLVTALIKDKILFKTRPKPIITSVPKK
V
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atggtgcaaattgttatttccagtgcgagggctggaggcctggcagaatgggtgctgatg
gagctacagggggagatcgaggctcgctacagcactggattagctggaaacctcctggga
gacctacattacaccactgagggaatccctgtgctgatcgtggggcatcatatcctgtat
gggaaaatcatccacctggagaaaccttttgcagtccttgtcaaacacactcctggggat
caggactgtgatgagcttggccgcgagactggcacccggtacctggtgacagcactcatc
aaagacaagatccttttcaaaacccgccccaagcccattatcaccagcgtccccaagaaa
gtatga

DBGET integrated database retrieval system