KEGG   Homo sapiens (human): 54928Help
Entry
54928             CDS       T01001                                 

Gene name
IMPAD1, GPAPP, IMP_3, IMP-3, IMPA3
Definition
(RefSeq) inositol monophosphatase domain containing 1
  KO
K15759  inositol monophosphatase 3 [EC:3.1.3.25 3.1.3.7]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa00920  Sulfur metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
Module
hsa_M00131  Inositol phosphate metabolism, Ins(1,3,4,5)P4 => Ins(1,3,4)P3 => myo-inositol
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    54928 (IMPAD1)
  09102 Energy metabolism
   00920 Sulfur metabolism
    54928 (IMPAD1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    54928 (IMPAD1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     54928 (IMPAD1)
    3.1.3.25  inositol-phosphate phosphatase
     54928 (IMPAD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Inositol_P
Motif
Other DBs
NCBI-GeneID: 54928
NCBI-ProteinID: NP_060283
OMIM: 614010
HGNC: 26019
Ensembl: ENSG00000104331
Vega: OTTHUMG00000164415
Pharos: Q9NX62(Tdark)
UniProt: Q9NX62 A0A024R7W0
Position
8q12.1
AA seq 359 aa AA seqDB search
MAPMGIRLSPLGVAVFCLLGLGVLYHLYSGFLAGRFSLFGLGGEPGGGAAGPAAAADGGT
VDLREMLAVSVLAAVRGGDEVRRVRESNVLHEKSKGKTREGAEDKMTSGDVLSNRKMFYL
LKTAFPSVQINTEEHVDAADQEVILWDHKIPEDILKEVTTPKEVPAESVTVWIDPLDATQ
EYTEDLRKYVTTMVCVAVNGKPMLGVIHKPFSEYTAWAMVDGGSNVKARSSYNEKTPRIV
VSRSHSGMVKQVALQTFGNQTTIIPAGGAGYKVLALLDVPDKSQEKADLYIHVTYIKKWD
ICAGNAILKALGGHMTTLSGEEISYTGSDGIEGGLLASIRMNHQALVRKLPDLEKTGHK
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggcccccatgggcatccgcctttccccactgggggtggcagtgttttgcctgctgggg
ctcggcgtgctctaccacctctactcgggcttcttggccggccgcttcagcctcttcggc
ctgggcggcgagcctggcggcggcgcggcggggcccgcggccgcggccgatgggggcacc
gtggacttgcgcgagatgctggctgtgtcagtgctggccgcagtccgcggcggcgacgag
gtgaggcgcgtccgcgagagcaacgtcctccacgagaagtccaaggggaagacgcgcgag
ggagccgaggacaagatgaccagcggcgacgtgctgtccaaccgcaagatgttctacctg
ctcaagaccgccttccccagcgtccagattaatactgaggaacacgtggatgcagctgat
caggaggttatcttgtgggatcataagattcctgaggatatcctaaaggaagtaactact
cctaaagaggtaccagcagaaagtgttactgtctggattgacccacttgatgctacacag
gaatatacagaggatcttcgaaagtacgtcactactatggtgtgtgtggctgtaaatggt
aaacccatgctaggagttatacataagccattttccgaatatacagcttgggcaatggta
gatggtggttcaaatgtgaaagcccgctcttcctacaatgagaagaccccaaggatcgtt
gtgtctcgttcccattcagggatggtcaaacaggtcgctcttcagacttttggaaaccag
actacaattatcccagctggtggtgctggttataaagttttagcacttttggatgtgcct
gataagagtcaagaaaaagctgatttatacatccatgtgacatacatcaaaaagtgggat
atatgtgctggtaatgccatcttaaaagccctaggggggcatatgactaccctgagtggt
gaagaaatcagttacactggttcagacggcattgaagggggactccttgctagcatcaga
atgaaccaccaggccctggtcagaaaactcccagatctagaaaagacaggacataaatga

DBGET integrated database retrieval system