KEGG   Homo sapiens (human): 54930Help
Entry
54930             CDS       T01001                                 

Gene name
HAUS4, C14orf94
Definition
(RefSeq) HAUS augmin like complex subunit 4
  KO
K16587  HAUS augmin-like complex subunit 4
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    54930 (HAUS4)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Augmin complex
    54930 (HAUS4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAUS4 HCMV_UL139
Motif
Other DBs
NCBI-GeneID: 54930
NCBI-ProteinID: NP_001159741
OMIM: 613431
HGNC: 20163
Ensembl: ENSG00000092036
Vega: OTTHUMG00000028710
Pharos: Q9H6D7(Tdark)
UniProt: Q9H6D7
Position
14q11.2
AA seq 363 aa AA seqDB search
MASGDFCSPGEGMEILQQVCSKQLPPCNLSKEDLLQNPYFSKLLLNLSQHVDESGLSLTL
AKEQAQAWKEVRLHKTTWLRSEILHRVIQELLVDYYVKIQDTNVTSEDKKFHETLEQRLL
VTELMRLLGPSQEREIPPLLGLEKADLLELMPLSEDFVWMRARLQQEVEEQLKKKCFTLL
CYYDPNSDADSETVKAAKVWKLAEVLVGEQQQCQDAKSQQKEQMLLLEKKSAAYSQVLLR
CLTLLQRLLQEHRLKTQSELDRINAQYLEVKCGAMILKLRMEELKILSDTYTVEKVEVHR
LIRDRLEGAIHLQEQDMENSRQVLNSYEVLGEEFDRLVKEYTVLKQATENKRWALQEFSK
VYR
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggcatccggggatttctgctcacctggagaagggatggaaatacttcaacaagtgtgc
agcaaacaacttcctccttgtaacctgagtaaagaggacctgttacagaacccatacttc
agcaagcttctcctgaatctctcacagcatgtggatgagagtggcttaagcctcacccta
gcaaaggagcaggctcaggcatggaaggaagttcgactgcataagacaacatggttgagg
tctgagattttacacagagtcattcaagagttgcttgtggactactatgtgaagatacaa
gacacaaatgtaacttctgaggacaaaaagtttcatgagacccttgaacagcggctgctt
gtaactgaactgatgcggctcttaggtcctagccaggagagggagatacctccactgctg
gggctggagaaagcggaccttctggaactcatgccactctcagaggattttgtgtggatg
agggctcggctacagcaagaagtagaggagcagctcaaaaagaaatgtttcactctgctc
tgctactatgatcccaattcagatgctgacagtgaaaccgtgaaggcagcaaaggtgtgg
aaactcgcagaggtcctggtgggtgagcagcagcagtgccaggatgccaagagccagcag
aaggagcagatgttgctgctggagaagaagagtgctgcttactcccaggtgcttctccgc
tgcctcactttgctgcagaggcttcttcaagaacaccggctgaagactcaatccgagcta
gaccgcatcaatgcccagtacctggaagtcaagtgcggtgctatgatccttaagctgagg
atggaggagctaaagattttgtccgacacttacactgttgagaaagtggaagttcatcgt
ctgattagggaccgtttggagggagccattcacctacaggagcaggacatggagaactca
agacaggtcctgaactcctatgaggtccttggggaggagtttgacaggctggtgaaagag
tacaccgtactcaagcaggcaacagagaacaagcggtgggccctccaggagttcagcaag
gtctaccgttga

DBGET integrated database retrieval system