KEGG   Homo sapiens (human): 54930
Entry
54930             CDS       T01001                                 
Symbol
HAUS4, C14orf94
Name
(RefSeq) HAUS augmin like complex subunit 4
  KO
K16587  HAUS augmin-like complex subunit 4
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    54930 (HAUS4)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation proteins
   Augmin complex
    54930 (HAUS4)
SSDB
Motif
Pfam: HAUS4 HCMV_UL139
Other DBs
NCBI-GeneID: 54930
NCBI-ProteinID: NP_001159741
OMIM: 613431
HGNC: 20163
Ensembl: ENSG00000092036
Pharos: Q9H6D7(Tdark)
UniProt: Q9H6D7
Position
14:complement(22946228..22957090)
AA seq 363 aa
MASGDFCSPGEGMEILQQVCSKQLPPCNLSKEDLLQNPYFSKLLLNLSQHVDESGLSLTL
AKEQAQAWKEVRLHKTTWLRSEILHRVIQELLVDYYVKIQDTNVTSEDKKFHETLEQRLL
VTELMRLLGPSQEREIPPLLGLEKADLLELMPLSEDFVWMRARLQQEVEEQLKKKCFTLL
CYYDPNSDADSETVKAAKVWKLAEVLVGEQQQCQDAKSQQKEQMLLLEKKSAAYSQVLLR
CLTLLQRLLQEHRLKTQSELDRINAQYLEVKCGAMILKLRMEELKILSDTYTVEKVEVHR
LIRDRLEGAIHLQEQDMENSRQVLNSYEVLGEEFDRLVKEYTVLKQATENKRWALQEFSK
VYR
NT seq 1092 nt   +upstreamnt  +downstreamnt
atggcatccggggatttctgctcacctggagaagggatggaaatacttcaacaagtgtgc
agcaaacaacttcctccttgtaacctgagtaaagaggacctgttacagaacccatacttc
agcaagcttctcctgaatctctcacagcatgtggatgagagtggcttaagcctcacccta
gcaaaggagcaggctcaggcatggaaggaagttcgactgcataagacaacatggttgagg
tctgagattttacacagagtcattcaagagttgcttgtggactactatgtgaagatacaa
gacacaaatgtaacttctgaggacaaaaagtttcatgagacccttgaacagcggctgctt
gtaactgaactgatgcggctcttaggtcctagccaggagagggagatacctccactgctg
gggctggagaaagcggaccttctggaactcatgccactctcagaggattttgtgtggatg
agggctcggctacagcaagaagtagaggagcagctcaaaaagaaatgtttcactctgctc
tgctactatgatcccaattcagatgctgacagtgaaaccgtgaaggcagcaaaggtgtgg
aaactcgcagaggtcctggtgggtgagcagcagcagtgccaggatgccaagagccagcag
aaggagcagatgttgctgctggagaagaagagtgctgcttactcccaggtgcttctccgc
tgcctcactttgctgcagaggcttcttcaagaacaccggctgaagactcaatccgagcta
gaccgcatcaatgcccagtacctggaagtcaagtgcggtgctatgatccttaagctgagg
atggaggagctaaagattttgtccgacacttacactgttgagaaagtggaagttcatcgt
ctgattagggaccgtttggagggagccattcacctacaggagcaggacatggagaactca
agacaggtcctgaactcctatgaggtccttggggaggagtttgacaggctggtgaaagag
tacaccgtactcaagcaggcaacagagaacaagcggtgggccctccaggagttcagcaag
gtctaccgttga

DBGET integrated database retrieval system