KEGG   Homo sapiens (human): 54931Help
Entry
54931             CDS       T01001                                 

Gene name
TRMT10C, COXPD30, HNYA, MRPP1, RG9MTD1
Definition
(RefSeq) tRNA methyltransferase 10C, mitochondrial RNase P subunit
  KO
K17654  mitochondrial ribonuclease P protein 1 [EC:2.1.1.-]
Organism
hsa  Homo sapiens (human)
Disease
H00891  Combined oxidative phosphorylation deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    54931 (TRMT10C)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     54931 (TRMT10C)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial ribonuclease P
    54931 (TRMT10C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA_m1G_MT
Motif
Other DBs
NCBI-GeneID: 54931
NCBI-ProteinID: NP_060289
OMIM: 615423
HGNC: 26022
Ensembl: ENSG00000174173
Vega: OTTHUMG00000159114
Pharos: Q7L0Y3(Tbio)
UniProt: Q7L0Y3
Structure
PDB: 

Position
3q12.3
AA seq 403 aa AA seqDB search
MAAFLKMSVSVNFFRPFTRFLVPFTLHRKRNNLTILQRYMSSKIPAVTYPKNESTPPSEE
LELDKWKTTMKSSVQEECVSTISSSKDEDPLAATREFIEMWRLLGREVPEHITEEELKTL
MECVSNTAKKKYLKYLYTKEKVKKARQIKKEMKAAAREEAKNIKLLETTEEDKQKNFLFL
RLWDRNMDIAMGWKGAQAMQFGQPLVFDMAYENYMKRKELQNTVSQLLESEGWNRRNVDP
FHIYFCNLKIDGALHRELVKRYQEKWDKLLLTSTEKSHVDLFPKDSIIYLTADSPNVMTT
FRHDKVYVIGSFVDKSMQPGTSLAKAKRLNLATECLPLDKYLQWEIGNKNLTLDQMIRIL
LCLKNNGNWQEALQFVPKRKHTGFLEISQHSQEFINRLKKAKT
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atggctgctttcctcaaaatgagtgttagtgtcaatttcttcagacctttcaccaggttt
ttggtgccatttacccttcataggaagagaaataacttaacaattttgcagagatacatg
tcttccaaaataccagctgttacttatcctaaaaatgagagtacacccccttctgaagag
ctagagttggataagtggaaaactaccatgaaatctagtgtgcaagaagaatgtgtttca
acaatctcaagcagtaaggatgaagatcctctagctgccaccagagagttcattgagatg
tggagattgcttggcagagaagtaccagaacacatcactgaagaagagctcaaaaccctt
atggaatgtgtttctaacacagcaaaaaaaaaatatttaaaatatttatatacgaaggaa
aaagtgaaaaaagctaggcaaataaaaaaggaaatgaaagcagcagcaagggaagaagca
aaaaatatcaagctgctagaaaccactgaggaagataaacagaaaaactttctattttta
cgactttgggataggaatatggacatagcaatgggctggaagggtgcccaggccatgcag
tttggacaacctttggtttttgacatggcttacgaaaattatatgaaacgaaaagaattg
cagaatactgtttcccagcttttagaaagtgaaggatggaacagaagaaatgttgatcct
ttccatatttatttctgcaatctaaaaatagatggtgctttgcacagagagttagttaaa
cggtatcaagaaaaatgggacaaattgcttttaacatcaacagaaaagtctcatgtagat
ttatttccaaaggacagtattatctatttaactgcagattctcccaatgttatgactact
ttcaggcatgacaaagtttatgtaattgggtcttttgttgataagagtatgcagccaggc
acatccctagccaaggcaaaacggctgaacctggcaactgaatgccttccattagataaa
tatttacaatgggaaattggtaacaaaaatctcaccttagatcaaatgatacgtattttg
ttatgtctgaaaaacaatggtaattggcaagaggctctgcaattcgttcccaagagaaaa
catactggttttctggagatttctcagcattctcaagagtttatcaacagactaaagaag
gcaaagacttaa

DBGET integrated database retrieval system