KEGG   Homo sapiens (human): 54936Help
Entry
54936             CDS       T01001                                 

Gene name
ADPRS, ADPRHL2, ARH3, CONDSIAS
Definition
(RefSeq) ADP-ribosylserine hydrolase
  KO
K11687  poly(ADP-ribose) glycohydrolase ARH3 [EC:3.2.1.143]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    54936 (ADPRS)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.143  poly(ADP-ribose) glycohydrolase
     54936 (ADPRS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADP_ribosyl_GH
Motif
Other DBs
NCBI-GeneID: 54936
NCBI-ProteinID: NP_060295
OMIM: 610624
HGNC: 21304
Ensembl: ENSG00000116863
Vega: OTTHUMG00000007628
Pharos: Q9NX46(Tbio)
UniProt: Q9NX46
Structure
PDB: 

Position
1p34.3
AA seq 363 aa AA seqDB search
MAAAAMAAAAGGGAGAARSLSRFRGCLAGALLGDCVGSFYEAHDTVDLTSVLRHVQSLEP
DPGTPGSERTEALYYTDDTAMARALVQSLLAKEAFDEVDMAHRFAQEYKKDPDRGYGAGV
VTVFKKLLNPKCRDVFEPARAQFNGKGSYGNGGAMRVAGISLAYSSVQDVQKFARLSAQL
THASSLGYNGAILQALAVHLALQGESSSEHFLKQLLGHMEDLEGDAQSVLDARELGMEER
PYSSRLKKIGELLDQASVTREEVVSELGNGIAAFESVPTAIYCFLRCMEPDPEIPSAFNS
LQRTLIYSISLGGDTDTIATMAGAIAGAYYGMDQVPESWQQSCEGYEETDILAQSLHRVF
QKS
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggccgcagcggcgatggcggcagcggcaggtggaggggctggcgcggcccgctccctc
tcgcgcttccgaggctgcctggctggcgcgctgctcggggactgcgtgggctccttctac
gaggcccacgacaccgtcgacctgacgtcagtcctgcgtcatgtccagagtctggagccg
gaccccggcacgcccgggagtgagcggacagaagccttgtactacacagatgacacagcc
atggccagggccctggtgcagtccctgctagccaaggaggcctttgacgaggtggacatg
gctcacagatttgctcaggagtacaagaaagaccctgacaggggctatggtgctggagta
gtcactgtcttcaagaagctcctgaaccccaaatgtcgcgatgtctttgagcctgcccgg
gcccagtttaacgggaaaggctcctatggcaatggaggtgccatgcgggtggctggcatc
tccctggcctatagcagtgtccaggatgtgcagaagtttgcccggctctcggcccagctg
acacacgcctcctccctgggttacaatggcgccatcctgcaggccctggctgtgcacctg
gccttgcagggcgagtcttccagcgagcactttctcaagcaactcctgggccacatggag
gatctggagggtgatgcccagtccgtcttggatgccagggagttgggcatggaggagcgt
ccatactccagccgcctgaagaagattggagagcttctagaccaggcatcggtgaccagg
gaggaagtggtgtctgagctagggaatggcattgctgcctttgagtcggtacccaccgcc
atctactgcttcctacgctgcatggagccagaccctgagatcccttctgccttcaatagc
ctccaaaggactctcatttattccatctcacttggtggggacacagacaccattgccacc
atggctggggccattgctggtgcctactatgggatggatcaggtgccagagagctggcag
caaagctgtgaaggctacgaggagacagacatcctggcccaaagcctgcaccgtgtcttc
cagaagagttga

DBGET integrated database retrieval system