KEGG   Homo sapiens (human): 5494Help
Entry
5494              CDS       T01001                                 

Gene name
PPM1A, PP2C-ALPHA, PP2CA, PP2Calpha
Definition
(RefSeq) protein phosphatase, Mg2+/Mn2+ dependent 1A
  KO
K04457  protein phosphatase 1A [EC:3.1.3.16]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    5494 (PPM1A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    5494 (PPM1A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     5494 (PPM1A)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Mg2+- or Mn2+- dependent protein phosphatases (PPMs)
   PPM1 phosphatases (PP2C)
    5494 (PPM1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PP2C PP2C_C
Motif
Other DBs
NCBI-GeneID: 5494
NCBI-ProteinID: NP_066283
OMIM: 606108
HGNC: 9275
Ensembl: ENSG00000100614
Vega: OTTHUMG00000140333
Pharos: P35813(Tchem)
UniProt: P35813 A0A024R6A5
Structure
PDB: 

Position
14q23.1
AA seq 382 aa AA seqDB search
MGAFLDKPKMEKHNAQGQGNGLRYGLSSMQGWRVEMEDAHTAVIGLPSGLESWSFFAVYD
GHAGSQVAKYCCEHLLDHITNNQDFKGSAGAPSVENVKNGIRTGFLEIDEHMRVMSEKKH
GADRSGSTAVGVLISPQHTYFINCGDSRGLLCRNRKVHFFTQDHKPSNPLEKERIQNAGG
SVMIQRVNGSLAVSRALGDFDYKCVHGKGPTEQLVSPEPEVHDIERSEEDDQFIILACDG
IWDVMGNEELCDFVRSRLEVTDDLEKVCNEVVDTCLYKGSRDNMSVILICFPNAPKVSPE
AVKKEAELDKYLECRVEEIIKKQGEGVPDLVHVMRTLASENIPSLPPGGELASKRNVIEA
VYNRLNPYKNDDTDSTSTDDMW
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgggagcatttttagacaagccaaagatggaaaagcataatgcccaggggcagggtaat
gggttgcgatatgggctaagcagcatgcaaggctggcgtgttgaaatggaggatgcacat
acggctgtgatcggtttgccaagtggacttgaatcgtggtcattctttgctgtgtatgat
gggcatgctggttctcaggttgccaaatactgctgtgagcatttgttagatcacatcacc
aataaccaggattttaaagggtctgcaggagcaccttctgtggaaaatgtaaagaatgga
atcagaacaggttttctggagattgatgaacacatgagagttatgtcagagaagaaacat
ggtgcagatagaagtgggtcaacagctgtaggtgtcttaatttctccccaacatacttat
ttcattaactgtggagactcaagaggtttactttgtaggaacaggaaagttcatttcttc
acacaagatcacaaaccaagtaatccgctggagaaagaacgaattcagaatgcaggtggc
tctgtaatgattcagcgtgtgaatggctctctggctgtatcgagggcccttggggatttt
gattacaaatgtgtccatggaaaaggtcctactgagcagcttgtctcaccagagcctgaa
gtccatgatattgaaagatctgaagaagatgatcagttcattatccttgcatgtgatggt
atctgggatgttatgggaaatgaagagctctgtgattttgtaagatccagacttgaagtc
actgatgaccttgagaaagtttgcaatgaagtagtcgacacctgtttgtataagggaagt
cgagacaacatgagtgtgattttgatctgttttccaaatgcacccaaagtatcgccagaa
gcagtgaagaaggaggcagagttggacaagtacctggaatgcagagtagaagaaatcata
aagaagcagggggaaggcgtccccgacttagtccatgtgatgcgcacattagcgagtgag
aacatccccagcctcccaccagggggtgaattggcaagcaagaggaatgttattgaagcc
gtttacaatagactgaatccttacaaaaatgacgacactgactctacatcaacagatgat
atgtggtaa

DBGET integrated database retrieval system