KEGG   Homo sapiens (human): 54940
Entry
54940             CDS       T01001                                 
Symbol
OCIAD1, ASRIJ, OCIA, TPA018
Name
(RefSeq) OCIA domain containing 1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: OCIA
Other DBs
NCBI-GeneID: 54940
NCBI-ProteinID: NP_001073308
OMIM: 619596
HGNC: 16074
Ensembl: ENSG00000109180
Pharos: Q9NX40(Tbio)
UniProt: Q9NX40 A0A024R9U3
Position
4:48805156..48861815
AA seq 245 aa
MNGRADFREPNAEVPRPIPHIGPDYIPTEEERRVFAECNDESFWFRSVPLAATSMLITQG
LISKGILSSHPKYGSIPKLILACIMGYFAGKLSYVKTCQEKFKKLENSPLGEALRSGQAR
RSSPPGHYYQKSKYDSSVSGQSSFVTSPAADNIEMLPHYEPIPFSSSMNESAPTGITDHI
VQGPDPNLEESPKRKNITYEELRNKNRESYEVSLTQKTDPSVRPMHERVPKKEVKVNKYG
DTWDE
NT seq 738 nt   +upstreamnt  +downstreamnt
atgaatgggagggctgattttcgagagccgaatgcagaggttccaagaccaattccccac
atagggcctgattacattccaacagaggaagaaaggagagtcttcgcagaatgcaatgat
gaaagcttctggttcagatctgtgcctttggctgcaacaagtatgttgattactcaagga
ttaattagtaaaggaatactttcaagtcatcccaaatatggttccatccctaaacttata
cttgcttgtatcatgggatactttgctggaaaactttcttatgtgaaaacttgccaagag
aaattcaagaaacttgaaaattccccccttggagaagctttacgatcaggacaagcacga
cgatcttcaccacctgggcactattatcaaaagtcaaaatatgactcaagtgtgagtggt
caatcatcttttgtgacatccccagcagcagacaacatagaaatgcttcctcattatgag
ccaattccattcagttcttctatgaatgaatctgctcccactggtattactgatcatatt
gtccaaggacctgatcccaaccttgaagaaagtcctaaaagaaaaaatattacatatgag
gaattaaggaataagaacagagagtcatatgaagtatctttaacacaaaagactgacccc
tcagtcaggcctatgcatgaaagagtgccaaaaaaagaagtcaaagtaaacaagtatgga
gatacttgggatgagtga

DBGET integrated database retrieval system