KEGG   Homo sapiens (human): 5495Help
Entry
5495              CDS       T01001                                 

Gene name
PPM1B, PP2C-beta, PP2C-beta-X, PP2CB, PP2CBETA, PPC2BETAX
Definition
(RefSeq) protein phosphatase, Mg2+/Mn2+ dependent 1B
  KO
K04461  protein phosphatase 1B [EC:3.1.3.16]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    5495 (PPM1B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    5495 (PPM1B)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     5495 (PPM1B)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Mg2+- or Mn2+- dependent protein phosphatases (PPMs)
   PPM1 phosphatases (PP2C)
    5495 (PPM1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PP2C PP2C_C PP2C_2
Motif
Other DBs
NCBI-GeneID: 5495
NCBI-ProteinID: NP_002697
OMIM: 603770
HGNC: 9276
Ensembl: ENSG00000138032
Vega: OTTHUMG00000128757
Pharos: O75688(Tchem)
UniProt: O75688
Structure
PDB: 

Position
2p21
AA seq 479 aa AA seqDB search
MGAFLDKPKTEKHNAHGAGNGLRYGLSSMQGWRVEMEDAHTAVVGIPHGLEDWSFFAVYD
GHAGSRVANYCSTHLLEHITTNEDFRAAGKSGSALELSVENVKNGIRTGFLKIDEYMRNF
SDLRNGMDRSGSTAVGVMISPKHIYFINCGDSRAVLYRNGQVCFSTQDHKPCNPREKERI
QNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVYEILRAEEDEFIIL
ACDGIWDVMSNEELCEYVKSRLEVSDDLENVCNWVVDTCLHKGSRDNMSIVLVCFSNAPK
VSDEAVKKDSELDKHLESRVEEIMEKSGEEGMPDLAHVMRILSAENIPNLPPGGGLAGKR
NVIEAVYSRLNPHRESDGASDEAEESGSQGKLVEALRQMRINHRGNYRQLLEEMLTSYRL
AKVEGEESPAEPAATATSSNSDAGNPVTMQESHTESESGLAELDSSNEDAGTKMSGEKI
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgggtgcatttttggataaacccaaaactgaaaaacataatgctcatggtgctgggaat
ggtttacgttatggcctgagcagcatgcaaggatggagagtggaaatggaagatgcacac
acagctgttgtaggtattcctcacggcttggaagactggtcattttttgcagtttatgat
ggtcatgctggatcccgagtggcaaattactgctcaacacatttattagaacacatcact
actaacgaagactttagggcagctggaaaatcaggatctgctcttgagctttcagtggaa
aatgttaagaatggtatcagaactggatttttgaaaattgatgaatacatgcgtaacttt
tcagacctcagaaacgggatggacaggagtggttcaactgcagtgggagttatgatttca
cctaagcatatctactttatcaactgtggtgattcacgtgctgttctgtataggaatgga
caagtctgcttttctacccaggatcacaaaccttgcaatccaagggaaaaggagcgaatc
caaaatgcaggaggcagcgtgatgatacaacgtgttaatggttcattagcagtatctcgt
gctctgggggactatgattacaagtgtgttgatggcaagggcccaacagaacaacttgtt
tctccagagcctgaggtttatgaaattttaagagcagaagaggatgaatttatcatcttg
gcttgtgatgggatctgggatgttatgagtaatgaggagctctgtgaatatgttaaatct
aggcttgaggtatctgatgacctggaaaatgtgtgcaattgggtagtggacacttgttta
cacaagggaagtcgagataacatgagtattgtactagtttgcttttcaaatgctcccaag
gtctcagatgaagcggtgaaaaaagattcagagttggataagcacttggaatcacgggtt
gaagagattatggagaagtctggcgaggaaggaatgcctgatcttgcccatgtcatgcgc
atcttgtctgcagaaaatatcccaaatttgcctcctgggggaggtcttgctggcaagcgt
aatgttattgaagctgtttatagtagactgaatccacatagagaaagtgatggggcctcc
gatgaagcagaggaaagtggatcacagggaaaattggtggaagctctcaggcaaatgaga
attaatcataggggaaactaccgacaacttctggaggagatgctgactagttacaggcta
gctaaagtagagggagaagaaagccctgctgaaccagctgccacagctacttcttcgaac
agtgatgctggaaacccagtgacaatgcaggaaagccatactgaatcagaaagtggtctt
gctgaattagacagctctaatgaagatgcagggacaaagatgagtggtgaaaaaatatga

DBGET integrated database retrieval system