KEGG   Homo sapiens (human): 54953
Entry
54953             CDS       T01001                                 
Symbol
ODR4, C1orf27, TTG1, odr-4
Name
(RefSeq) odr-4 GPCR localization factor homolog
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: ODR4-like
Other DBs
NCBI-GeneID: 54953
NCBI-ProteinID: NP_060317
OMIM: 609335
HGNC: 24299
Ensembl: ENSG00000157181
Pharos: Q5SWX8(Tdark)
UniProt: Q5SWX8
Position
1:186375838..186435031
AA seq 454 aa
MGRTYIVEETVGQYLSNINLQGKAFVSGLLIGQCSSQKDYVILATRTPPKEEQSENLKHP
KAKLDNLDEEWATEHACQVSRMLPGGLLVLGVFIITTLELANDFQNALRRLMFAVEKSIN
RKRLWNFTEEEVSERVTLHICASTKKIFCRTYDIHDPKSSARPADWKYQSGLSSSWLSLE
CTVHINIHIPLSATSVSYTLEKNTKNGLTRWAKEIENGVYLINGQVKDEDCDLLEGQKKS
SRGNTQATSHSFDVRVLTQLLLNSDHRSTATVQICSGSVNLKGAVKCRAYIHSSKPKVKD
AVQAVKRDILNTVADRCEMLFEDLLLNEIPEKKDSEKEFHVLPYRVFVPLPGSTVMLCDY
KFDDESAEEIRDHFMEMLDHTIQIEDLEIAEETNTACMSSSMNSQASLDNTDDEQPKQPI
KTTMLLKIQQNIGVIAAFTVAVLAAGISFHYFSD
NT seq 1365 nt   +upstreamnt  +downstreamnt
atgggaagaacctacattgtagaagagactgttggccagtatctttcaaacataaatctc
caaggaaaggcttttgtctctggccttttaataggacagtgttcgtcacaaaaggattat
gtgattcttgccactagaacgccacccaaagaggagcaaagtgagaacctcaaacatccc
aaagctaagttggataacttggatgaagaatgggccacagaacatgcctgccaggtatcc
agaatgctaccagggggacttttagttcttggagtatttattattactactttagaactg
gcaaatgattttcaaaatgccctgcgtagactaatgtttgctgtggaaaagtctataaat
agaaagagattgtggaatttcacagaggaggaagtctcagaacgagtgacacttcacatt
tgtgcttctacaaaaaaaatattttgtcgaacttatgatatccatgatccaaagagttca
gcaagaccagcagattggaagtatcaaagtggattatcatcctcatggctttctttagag
tgtacagttcacattaatattcacatcccactttctgctacttctgtcagctatactctg
gagaaaaatacaaagaatggacttacacgctgggccaaggaaatagaaaatggtgtttat
ttgattaatggacaagttaaagatgaagattgtgacctattagaaggacagaaaaaatct
tctagaggaaatactcaagcaactagtcattcttttgatgtcagagtgctaacgcagttg
ctcctgaattcagaccacagatccacagccacagtccagatatgtagcggttctgtaaac
cttaagggtgctgtgaaatgcagagcttatatccacagcagtaaacccaaagttaaagat
gctgtgcaggcagtaaagagggatatattgaacacagttgctgatcgttgtgaaatgcta
tttgaggatctgcttttgaatgaaattccagaaaaaaaagattctgaaaaagagttccac
gtcctcccttatcgagtctttgttccccttcctggatccactgtaatgttgtgtgattat
aaatttgacgatgagtcagctgaagaaatcagggaccattttatggagatgttggatcac
acaattcaaatagaagatttggaaattgcagaggaaacaaacacagcttgtatgagttct
tctatgaatagtcaagcttcattggacaacacagatgatgaacaaccaaaacaaccaatt
aaaactacaatgttattgaaaattcagcaaaacataggtgtgattgcagcatttacagtt
gcagtccttgctgcgggtatctcctttcattacttcagtgattag

DBGET integrated database retrieval system