KEGG   Homo sapiens (human): 54955
Entry
54955             CDS       T01001                                 
Symbol
C1orf109
Name
(RefSeq) chromosome 1 open reading frame 109
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: CK2S
Other DBs
NCBI-GeneID: 54955
NCBI-ProteinID: NP_060320
OMIM: 614799
HGNC: 26039
Ensembl: ENSG00000116922
Pharos: Q9NX04(Tdark)
UniProt: Q9NX04
Position
1:complement(37681570..37692242)
AA seq 203 aa
MTQDRPLLAVQEALKKCFPVVEEQQGLWQSALRDCQPLLSSLSNLAEQLQAAQNLRFEDV
PALRAFPDLKERLRRKQLVAGDIVLDKLGERLAILLKVRDMVSSHVERVFQIYEQHADTV
GIDAVLQPSAVSPSVADMLEWLQDIERHYRKSYLKRKYLLSSIQWGDLANIQALPKAWDR
ISKDEHQDLVQDILLNVSFFLEE
NT seq 612 nt   +upstreamnt  +downstreamnt
atgactcaagaccggcctctgcttgccgtgcaggaggcgctgaagaagtgcttccccgtg
gtggaggagcagcagggcctgtggcagagtgccctgcgggactgccagcccctcctgtcc
tccctcagcaacctggcggaacagctgcaggccgcacagaacctgcggtttgaggatgtg
ccggcgcttcgggccttcccagatttaaaagagcggctgaggcgtaagcagctggtggct
ggtgacatcgtcctggacaagctaggggaaaggctagccatcctcctcaaggtgcgagac
atggtcagcagccatgtggagcgagtgtttcagatctatgagcaacacgcagacacagtt
ggcattgatgctgtcctgcagccttcagcagtgagcccctctgtggctgacatgttggaa
tggttgcaggatattgagagacattatcgaaagtcgtacctgaagagaaagtatcttctt
tcgtctatccagtggggagacttggcaaacatacaagctttgcccaaggcctgggaccga
atttcaaaagacgaacaccaagatcttgtacaagatatcctattgaatgtttccttcttc
ctggaagagtaa

DBGET integrated database retrieval system