KEGG   Homo sapiens (human): 54959Help
Entry
54959             CDS       T01001                                 

Gene name
ODAM, APIN
Definition
(RefSeq) odontogenic, ameloblast associated
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: ODAM
Motif
Other DBs
NCBI-GeneID: 54959
NCBI-ProteinID: NP_060325
OMIM: 614843
HGNC: 26043
Ensembl: ENSG00000109205
Vega: OTTHUMG00000129406
Pharos: A1E959(Tbio)
UniProt: A1E959
Position
4q13.3
AA seq 279 aa AA seqDB search
MKIIILLGFLGATLSAPLIPQRLMSASNSNELLLNLNNGQLLPLQLQGPLNSWIPPFSGI
LQQQQQAQIPGLSQFSLSALDQFAGLLPNQIPLTGEASFAQGAQAGQVDPLQLQTPPQTQ
PGPSHVMPYVFSFKMPQEQGQMFQYYPVYMVLPWEQPQQTVPRSPQQTRQQQYEEQIPFY
AQFGYIPQLAEPAISGGQQQLAFDPQLGTAPEIAVMSTGEEIPYLQKEAINFRHDSAGVF
MPSTSPKPSTTNVFTSAVDQTITPELPEEKDKTDSLREP
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattataattcttcttggattcctgggagccacattgtcagccccacttatccca
cagcgtctcatgtctgccagcaatagcaatgagttacttcttaatcttaataatggtcaa
cttttgccactacaacttcagggcccacttaattcatggattccacctttctctggaatt
ttacaacagcagcagcaggctcaaattccaggactctcccagttctctttatcagctcta
gaccagtttgctggactgctcccaaatcagatacccttaacaggagaggccagttttgcc
caaggagcccaggcaggccaagttgatcccttacagcttcaaacaccgcctcagacacaa
ccaggccccagtcacgtgatgccctatgtattctccttcaaaatgcctcaagagcaagga
cagatgtttcaatactatccagtttacatggtcctaccctgggaacaacctcagcaaaca
gttccaaggtcacctcaacaaacaagacagcaacagtatgaggagcagataccattctat
gctcaatttggatacattccacaactagcagaacctgctatatcaggaggacagcagcaa
ctagcttttgatccccaactaggcacagctcctgaaattgctgtgatgtcaacaggagaa
gagataccatatttacaaaaagaagcgatcaactttagacatgacagtgcaggagttttc
atgccctcaacttcaccaaaacccagcacaaccaatgttttcacttctgctgtagaccaa
actattaccccagagctcccagaagagaaggacaagactgacagcctaagggaaccataa

DBGET integrated database retrieval system