KEGG   Homo sapiens (human): 54960
Entry
54960             CDS       T01001                                 

Gene name
GEMIN8, FAM51A1
Definition
(RefSeq) gem nuclear organelle associated protein 8
  KO
K13136  gem associated protein 8
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  RNA transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    54960 (GEMIN8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    54960 (GEMIN8)
Spliceosome [BR:hsa03041]
 Other splicing related proteins
  Proteins involved in snRNP biogenesis
   SMN complex factors
    54960 (GEMIN8)
SSDB
Motif
Pfam: GEMIN8
Other DBs
NCBI-GeneID: 54960
NCBI-ProteinID: NP_001035944
OMIM: 300962
HGNC: 26044
Ensembl: ENSG00000046647
Vega: OTTHUMG00000021160
Pharos: Q9NWZ8(Tdark)
UniProt: Q9NWZ8 A0A024RBX2
Position
Xp22.2
AA seq 242 aa
MAAVKASTSKATRPWYSHPVYARYWQHYHQAMAWMQSHHNAYRKAVESCFNLPWYLPSAL
LPQSSYDNEAAYPQSFYDHHVAWQDYPCSSSHFRRSGQHPRYSSRIQASTKEDQALSKEE
EMETESDAEVECDLSNMEITEELRQYFAETERHREERRRQQQLDAERLDSYVNADHDLYC
NTRRSVEAPTERPGERRQAEMKRLYGDSAAKIQAMEAAVQLSFDKHCDRKQPKYWPVIPL
KF
NT seq 729 nt   +upstreamnt  +downstreamnt
atggcagcggtaaaggcatcaacatcgaaagctaccaggccttggtattctcatccggta
tatgcaagatactggcaacattatcatcaagcaatggcttggatgcaaagccatcacaat
gcctacaggaaggccgtggaatcctgtttcaatcttccatggtacttaccttctgcgctt
cttccccaaagctcttacgataatgaggctgcgtatcctcagtccttctatgaccatcat
gtggcctggcaggactacccctgcagttcttcacatttcagaagatctgggcagcatcca
cgttacagcagtaggatccaggcatccacaaaagaagaccaagctttgtccaaagaggaa
gagatggagactgagtcagatgcagaggtagaatgtgacctgagcaatatggaaatcact
gaagagctccgccagtactttgcagagaccgagaggcatagagaagaacgacggcggcag
cagcagctggatgcagagcgcctggacagctatgtgaacgctgaccacgacctgtactgc
aacacccgccggtcggtagaagccccaactgagaggcctggtgagcggcgccaggccgag
atgaagcgtttgtacggggacagtgctgccaagatccaagccatggaggccgcggtgcag
ctgagctttgacaagcactgtgaccgaaagcagcccaagtactggccggtcatccccctg
aagttctga

DBGET integrated database retrieval system