KEGG   Homo sapiens (human): 54963Help
Entry
54963             CDS       T01001                                 

Gene name
UCKL1, UCK1L, URKL1
Definition
(RefSeq) uridine-cytidine kinase 1 like 1
  KO
K00876  uridine kinase [EC:2.7.1.48]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00240  Pyrimidine metabolism
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    54963 (UCKL1)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    54963 (UCKL1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.48  uridine kinase
     54963 (UCKL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UPRTase PRK CPT AAA_18 AAA_33 Cytidylate_kin Zeta_toxin CoaE AAA_17
Motif
Other DBs
NCBI-GeneID: 54963
NCBI-ProteinID: NP_060329
OMIM: 610866
HGNC: 15938
Ensembl: ENSG00000198276
Vega: OTTHUMG00000033003
Pharos: Q9NWZ5(Tbio)
UniProt: Q9NWZ5 Q53HM1
Position
20q13.33
AA seq 548 aa AA seqDB search
MAAPPARADADPSPTSPPTARDTPGRQAEKSETACEDRSNAESLDRLLPPVGTGRSPRKR
TTSQCKSEPPLLRTSKRTIYTAGRPPWYNEHGTQSKEAFAIGLGGGSASGKTTVARMIIE
ALDVPWVVLLSMDSFYKVLTEQQQEQAAHNNFNFDHPDAFDFDLIISTLKKLKQGKSVKV
PIYDFTTHSRKKDWKTLYGANVIIFEGIMAFADKTLLELLDMKIFVDTDSDIRLVRRLRR
DISERGRDIEGVIKQYNKFVKPSFDQYIQPTMRLADIVVPRGSGNTVAIDLIVQHVHSQL
EERELSVRAALASAHQCHPLPRTLSVLKSTPQVRGMHTIIRDKETSRDEFIFYSKRLMRL
LIEHALSFLPFQDCVVQTPQGQDYAGKCYAGKQITGVSILRAGETMEPALRAVCKDVRIG
TILIQTNQLTGEPELHYLRLPKDISDDHVILMDCTVSTGAAAMMAVRVLLDHDVPEDKIF
LLSLLMAEMGVHSVAYAFPRVRIITTAVDKRVNDLFRIIPGIGNFGDRYFGTDAVPDGSD
EEEVAYTG
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgcccccggcccgcgcggacgctgatccttcgcccacgtcgccacctacggcc
cgagacacaccaggccggcaggctgagaaaagcgagaccgcgtgcgaggaccgcagcaat
gcagagtccctggacaggctcctgccacctgtgggcactgggcgctctccccggaagcgg
accaccagccagtgcaagtcagagcctcccctgctgcgtacaagcaagcgtaccatctac
accgccgggcggccgccctggtacaatgaacacggcacgcaatccaaagaggccttcgcc
atcggcttgggaggcggcagtgcctctgggaagaccactgtggccagaatgatcatcgag
gccctggatgtgccctgggtggtcttgctgtccatggactccttctacaaggtgctgact
gagcagcagcaggaacaggccgcacacaacaacttcaacttcgaccacccagatgccttt
gacttcgacctcatcatttccaccctcaagaagctgaagcaggggaagagtgtcaaggtg
cccatttatgacttcaccacgcacagccggaagaaggactggaaaacactgtatggtgca
aacgtcatcatctttgagggcatcatggcctttgctgacaagacactgttggagctcctg
gacatgaagatctttgtggacacagactccgacatccgcctggtacggcggctgcgccgg
gacatcagtgagcgcggccgggacatcgagggtgtcatcaagcagtacaacaagtttgtc
aagccctccttcgaccagtacatccagcccaccatgcgcctggcagacatcgtggtcccc
agagggagcggcaacacggtggccatcgacctgattgtgcagcacgtgcacagccagctg
gaggagcgtgaactcagcgtcagggctgcgctggcctcggcacaccagtgccacccgctg
ccccggacgctgagcgtcctgaagagcacgccgcaggtacggggcatgcacaccatcatc
agggacaaggagaccagtcgcgacgagttcatcttctactccaagagactgatgcggctg
ctcatcgagcacgcgctctccttcctgccctttcaggactgcgtcgtacagaccccgcag
gggcaggactatgcgggcaagtgctatgcggggaagcagatcaccggtgtgtccattctg
cgcgccggtgaaaccatggagcccgcgctgcgcgctgtgtgcaaagacgtgcgcatcggc
accatcctcatccagaccaaccagcttaccggggagcccgagctccactacctgaggctg
cccaaggacatcagcgatgaccacgtgatcctcatggactgcaccgtgtccacgggcgcg
gcggccatgatggcagtgcgcgtgctcctggaccacgacgtgcctgaggacaagatcttt
ttgctgtcgctgctcatggcagagatgggcgtgcactcagtggcctatgcatttccgcga
gtgagaatcatcaccacggcggtggacaagcgggtcaatgaccttttccgcatcatccca
ggcattgggaactttggcgaccgctactttgggacagacgcggtccccgatggcagtgac
gaggaggaagtggcctacacgggttag

KEGG   Homo sapiens (human): 7371Help
Entry
7371              CDS       T01001                                 

Gene name
UCK2, TSA903, UK, UMPK
Definition
(RefSeq) uridine-cytidine kinase 2
  KO
K00876  uridine kinase [EC:2.7.1.48]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00240  Pyrimidine metabolism
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    7371 (UCK2)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    7371 (UCK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.48  uridine kinase
     7371 (UCK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PRK CoaE AAA_18 Zeta_toxin Cytidylate_kin AAA_17 T3SS_needle_reg
Motif
Other DBs
NCBI-GeneID: 7371
NCBI-ProteinID: NP_036606
OMIM: 609329
HGNC: 12562
Ensembl: ENSG00000143179
Vega: OTTHUMG00000040117
Pharos: Q9BZX2(Tbio)
UniProt: Q9BZX2 A0A024R912
Structure
PDB: 

Position
1q24.1
AA seq 261 aa AA seqDB search
MAGDSEQTLQNHQQPNGGEPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDYRQKQVVILS
QDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSHSRK
EETVTVYPADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQ
ILSQYITFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHIQDILNGGPSKRQTNG
CLNGYTPSRKRQASESSSRPH
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggccggggacagcgagcagaccctgcagaaccaccagcagcccaacggcggcgagccc
ttccttataggcgtcagcgggggaacagctagcggcaagtcttccgtgtgtgctaagatc
gtgcagctcctggggcagaatgaggtggactatcgccagaagcaggtggtcatcctgagc
caggatagcttctaccgtgtccttacctcggagcagaaggccaaagccctgaagggccag
ttcaactttgaccacccggatgcctttgacaatgaactcattctcaaaacactcaaagaa
atcactgaagggaaaacagtccagatccccgtgtatgactttgtctcccattcccggaag
gaggagacagttactgtctatcccgcagacgtggtgctctttgaagggatcctggccttc
tactcccaggaggtacgagacctgttccagatgaagctttttgtggatacagatgcggac
acccggctctcacgcagagtattaagggacatcagcgagagaggcagggatcttgagcag
attttatctcagtacattacgttcgtcaagcctgcctttgaggaattctgcttgccaaca
aagaagtatgctgatgtgatcatccctagaggtgcagataatctggtggccatcaacctc
atcgtgcagcacatccaggacatcctgaatggagggccctccaaacggcagaccaatggc
tgtctcaacggctacaccccttcacgcaagaggcaggcatcggagtccagcagcaggccg
cattga

KEGG   Homo sapiens (human): 83549Help
Entry
83549             CDS       T01001                                 

Gene name
UCK1, URK1
Definition
(RefSeq) uridine-cytidine kinase 1
  KO
K00876  uridine kinase [EC:2.7.1.48]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00240  Pyrimidine metabolism
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    83549 (UCK1)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    83549 (UCK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.48  uridine kinase
     83549 (UCK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PRK CoaE AAA_18 Zeta_toxin AAA_17 T2SSE AAA_33 LTXXQ
Motif
Other DBs
NCBI-GeneID: 83549
NCBI-ProteinID: NP_113620
OMIM: 609328
HGNC: 14859
Ensembl: ENSG00000130717
Vega: OTTHUMG00000020823
Pharos: Q9HA47(Tbio)
UniProt: Q9HA47
Structure
PDB: 

Position
9q34.13
AA seq 277 aa AA seqDB search
MASAGGEDCESPAPEADRPHQRPFLIGVSGGTASGKSTVCEKIMELLGQNEVEQRQRKVV
ILSQDRFYKVLTAEQKAKALKGQYNFDHPDAFDNDLMHRTLKNIVEGKTVEVPTYDFVTH
SRLPETTVVYPADVVLFEGILVFYSQEIRDMFHLRLFVDTDSDVRLSRRVLRDVRRGRDL
EQILTQYTTFVKPAFEEFCLPTKKYADVIIPRGVDNMVAINLIVQHIQDILNGDICKWHR
GGSNGRSYKRTFSEPGDHPGMLTSGKRSHLESSSRPH
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atggcttcggcgggaggcgaagactgcgagagccccgcgccggaggccgaccgtccgcac
cagcggcccttcctgataggggtgagcggcggcactgccagcgggaagtcgaccgtgtgt
gagaagatcatggagttgctgggacagaacgaggtggaacagcggcagcggaaggtggtc
atcctgagccaggacaggttctacaaggtcctgacggcagagcagaaggccaaggccttg
aaaggacagtacaattttgaccatccagatgcctttgataatgatttgatgcacaggact
ctgaagaacatcgtggagggcaaaacggtggaggtgccgacctatgattttgtgacacac
tcaaggttaccagagaccacggtggtctaccctgcggacgtggttctgtttgagggcatc
ttggtgttctacagccaggagatccgggacatgttccacctgcgcctcttcgtggacacc
gactccgacgtcaggctgtctcgaagagttctccgggacgtgcgccgagggagggacctg
gagcagattctgacgcagtacaccaccttcgtgaagccggccttcgaggagttctgcctg
ccgacaaagaagtatgccgatgtgatcatcccgcgaggagtggacaatatggttgccatc
aacctgatcgtgcagcacatccaggacattctgaatggtgacatctgcaaatggcaccga
ggagggtccaatgggcggagctacaagcggaccttttctgagccaggggaccaccctggg
atgctgacctctggcaaacggtcacatttggagtccagcagcagaccccactga

DBGET integrated database retrieval system