KEGG   Homo sapiens (human): 54967
Entry
54967             CDS       T01001                                 
Symbol
CT55, BJHCC20A, CXorf48
Name
(RefSeq) cancer/testis antigen 55
  KO
K25478  cancer/testis antigen 55
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    54967 (CT55)
SSDB
Motif
Pfam: S1-like
Other DBs
NCBI-GeneID: 54967
NCBI-ProteinID: NP_001026875
HGNC: 26047
Ensembl: ENSG00000169551
Pharos: Q8WUE5(Tdark)
UniProt: Q8WUE5
Position
X:complement(135156536..135171827)
AA seq 264 aa
MLRLLRLALAFYGRTADPAERQGPQQQGLPQGDTQLTTVQGVVTSFCGDYGMIDESIYFS
SDVVTGNVPLKVGQKVNVVVEEDKPHYGLRAIKVDVVPRHLYGAGPSDSGTRVLIGCVTS
INEDNIYISNSIYFSIAIVSEDFVPYKGDLLEVEYSTEPGISNIKATSVKPIRCIHTEEV
CITSVHGRNGVIDYTIFFTLDSVKLPDGYVPQVDDIVNVVMVESIQFCFIWRAISITPVH
KSSSGFQDDGGLGRPKRERRSQSI
NT seq 795 nt   +upstreamnt  +downstreamnt
atgctcaggcttctgagacttgctttggccttctacgggaggacggccgaccctgcagag
cgacagggcccacagcagcagggcctcccacaaggtgacacccagttgacaactgtgcag
ggagttgtcacaagtttctgtggtgattatggcatgattgatgagtcgatctacttcagt
agtgatgttgtgactggcaacgtgcctctaaaagttggacaaaaagttaatgtggttgtg
gaagaagataaaccacattatggattgagagcaatcaaggtggatgttgtgcctcgccat
ctttatggtgctggaccctcagactcaggaaccagagttttaattggatgtgttacttct
ataaatgaagataatatttatattagtaacagcatttatttttccatagccattgtttct
gaagattttgtgccttataagggtgacttgttagaagttgaatattccactgagccaggc
atctcaaacatcaaggcaacttctgtgaagcccatccgttgtattcatacggaagaggtc
tgcattactagcgtacatggaagaaatggggtgatagattatactatttttttcaccttg
gattctgtgaaacttcctgatggatacgtacctcaagtagatgatatcgtcaatgtggtc
atggtggagagcattcagttctgctttatttggagagcgatttctatcaccccagtgcat
aaatccagcagcggattccaggatgacggaggcctgggacggcccaaaagggaacgtcgg
agccaaagcatttaa

DBGET integrated database retrieval system