KEGG   Homo sapiens (human): 54972
Entry
54972             CDS       T01001                                 

Gene name
TMEM132A, GBP, HSPA5BP1
Definition
(RefSeq) transmembrane protein 132A
  KO
K17599  transmembrane protein 132
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    54972 (TMEM132A)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     54972 (TMEM132A)
SSDB
Motif
Pfam: TMEM132 TMEM132D_N TMEM132D_C
Other DBs
NCBI-GeneID: 54972
NCBI-ProteinID: NP_821174
OMIM: 617363
HGNC: 31092
Ensembl: ENSG00000006118
Vega: OTTHUMG00000167803
Pharos: Q24JP5(Tdark)
UniProt: Q24JP5
Position
11q12.2
AA seq 1023 aa
MCARMAGRTTAAPRGPYGPWLCLLVALALDVVRVDCGQAPLDPVYLPAALELLDAPEHFR
VQQVGHYPPANSSLSSRSETFLLLQPWPRAQPLLRASYPPFATQQVVPPRVTEPHQRPVP
WDVRAVSVEAAVTPAEPYARVLFHLKGQDWPPGSGSLPCARLHATHPAGTAHQACRFQPS
LGACVVELELPSHWFSQASTTRAELAYTLEPAAEGPGGCGSGEENDPGEQALPVGGVELR
PADPPQYQEVPLDEAVTLRVPDMPVRPGQLFSATLLLRHNFTASLLTLRIKVKKGLHVTA
ARPAQPTLWTAKLDRFKGSRHHTTLITCHRAGLTEPDSSPLELSEFLWVDFVVENSTGGG
VAVTRPVTWQLEYPGQAPEAEKDKMVWEILVSERDIRALIPLAKAEELVNTAPLTGVPQH
VPVRLVTVDGGGALVEVTEHVGCESANTQVLQVSEACDAVFVAGKESRGARGVRVDFWWR
RLRASLRLTVWAPLLPLRIELTDTTLEQVRGWRVPGPAEGPAEPAAEASDEAERRARGCH
LQYQRAGVRFLAPFAAHPLDGGRRLTHLLGPDWLLDVSHLVAPHARVLDSRVASLEGGRV
VVGREPGVTSIEVRSPLSDSILGEQALAVTDDKVSVLELRVQPVMGISLTLSRGTAHPGE
VTATCWAQSALPAPKQEVALSLWLSFSDHTVAPAELYDRRDLGLSVSAEEPGAILPAEEQ
GAQLGVVVSGAGAEGLPLHVALHPPEPCRRGRHRVPLASGTAWLGLPPASTPAPALPSSP
AWSPPATEATMGGKRQVAGSVGGNTGVRGKFERAEEEARKEETEAREEEEEEEEEMVPAP
QHVTELELGMYALLGVFCVAIFIFLVNGVVFVLRYQRKEPPDSATDPTSPQPHNWVWLGT
DQEELSRQLDRQSPGPPKGEGSCPCESGGGGEAPTLAPGPPGGTTSSSSTLARKEAGGRR
KRVEFVTFAPAPPAQSPEEPVGAPAVQSILVAGEEDIRWVCEDMGLKDPEELRNYMERIR
GSS
NT seq 3072 nt   +upstreamnt  +downstreamnt
atgtgcgcgcggatggccggtcgcacaacagcggcccctcgggggccctacggcccctgg
ctctgcctcctggtggccctcgccctggacgtcgtgagagtggactgtggccaggctccc
ctggaccctgtctacctgccggcagccctggagctcctagacgcccctgaacacttccgt
gtgcagcaggtgggccactacccacctgccaactcctctctgagctcccgatctgagacc
tttctgctcctacagccctggcccagggcccagccacttctccgggcctcctacccacct
tttgccactcagcaggtggtcccccctcgagtcactgagccccaccaacggccagtccca
tgggacgtgcgggccgtttcagtggaagcggctgtgactccagcagagccctacgcccgg
gttctcttccacctcaaagggcaggattggccaccagggtctggcagcctgccctgtgcc
cggctccatgccacacaccctgccggcactgctcaccaagcctgccgcttccagccatcc
ctgggcgcctgcgtggtggagctggagcttccctcgcactggttctcacaggcctccacc
acacgggccgagctggcctacacgcttgagcctgcagctgagggccctgggggctgtggc
tccggcgaggagaacgaccctggggagcaggccctcccagtggggggtgtggagctgcgc
ccagcagaccccccgcagtaccaggaggtacctctggacgaggctgtgactctgcgggtg
cctgacatgccagtgcggcccggccagctctttagtgctaccctcctgcttcggcacaac
ttcacagccagcctcctgaccctgcggatcaaggtgaagaaggggctgcatgtgacagcc
gcccgcccagcccagcccacactctggactgccaagctggaccgcttcaagggctccagg
caccacaccaccctcatcacctgccaccgtgctgggctcacagagccagattccagtccc
cttgaactgtctgagttcctatgggtggactttgtggtggagaatagcactggtgggggc
gtagcggtcactcgccccgtcacgtggcagctggagtacccaggccaggcccctgaagca
gagaaggacaaaatggtgtgggaaatcctggtgtctgagcgggacatcagagcccttatc
ccactggccaaggctgaggagctggtgaatacagcaccactgactggagtgccccagcat
gtccccgtgcgccttgtcactgtggacggcgggggggccttggtggaggtgacagagcat
gtcggctgcgagtctgccaacacacaggtcctgcaggtgtctgaggcctgtgatgccgtg
ttcgtggctggcaaggagagccggggcgcccggggggtgcgagtggacttctggtggcgc
cggctccgcgcctcgctgcggctgaccgtgtgggcccccctgctaccgctgcgtatcgag
ctcaccgacaccaccctcgagcaggtccgcggctggagggtacctggccctgctgaaggg
cctgcggaacccgctgcagaggcgtcggatgaggccgagcggcgcgcccgtggctgccac
ctgcagtaccagcgggccggtgtgcgcttcctcgcccccttcgcggcccacccgctggac
ggcggccgccgcctcacgcacctgcttggccccgactggctgctagacgtgtcccacctc
gtggcgccacacgcccgcgtgctggactcgcgtgtagcctctctggagggtggccgtgtc
gtggtgggccgggagcccggtgtcacctccattgaggtgcgttccccactgtctgactcc
atcctgggggagcaggcgctggctgtgacggacgacaaggtctcagtgctggagctgagg
gtgcagccagtgatgggcatctcgctgaccttgagccggggcactgcccaccccggggag
gtcacagctacgtgctgggcacagtcagcccttcccgccccaaagcaggaggtggccctc
tccctatggctgtccttctctgatcacactgtggccccagctgagctctacgaccgccgt
gacctgggactgtccgtctcagccgaggagcctggtgccatcctgccagctgaggagcag
ggtgcccagctcggggtggtggtgagtggggcaggcgccgaggggctgccgctgcatgtg
gctctgcacccgcccgagccctgccgccggggccgccaccgtgtgcctctggcctctggc
accgcctggctggggctgccccctgcctccactccagcccctgctctcccatccagccct
gcttggagcccaccagccacagaagccaccatgggtggtaaacggcaggtggcaggcagt
gtcgggggcaacacaggtgtgaggggcaagtttgagcgggcagaggaggaggccaggaag
gaggagaccgaagccagggaggaggaggaggaagaggaggaggagatggtccctgcccct
cagcatgtcactgagctagagctgggcatgtacgccctgctgggagtcttctgcgtggcc
atcttcatcttcttggtcaatggtgtggtcttcgtcctgcgctatcagcgcaaagaacct
cccgacagtgccactgaccccacctccccccagccccacaactgggtctggctgggcact
gaccaggaggaactgagccgccagctggaccggcagtcccctggcccgcccaagggggag
gggagctgcccctgtgagagtgggggaggaggggaggcccctaccctggcccctggccct
cctgggggcaccaccagctcctcaagcaccctggcccgaaaggaggctggggggcggcgg
aagcgagtagagtttgtgacatttgcgccagcccctccagcccagtcacctgaggagcct
gtaggggcccctgctgtgcagtccatccttgtggcaggcgaggaggacatccgctgggtg
tgtgaggacatggggctgaaggaccctgaggagcttcgcaactacatggagaggatccgg
ggcagctcctga

DBGET integrated database retrieval system