KEGG   Homo sapiens (human): 54974
Entry
54974             CDS       T01001                                 

Symbol
THG1L, ICF45, IHG-1, IHG1, SCAR28, THG1, hTHG1
Name
(RefSeq) tRNA-histidine guanylyltransferase 1 like
  KO
K10761  tRNA(His) guanylyltransferase [EC:2.7.7.79]
Organism
hsa  Homo sapiens (human)
Disease
H01891  Autosomal recessive spinocerebellar ataxias
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hsa03016]
    54974 (THG1L)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.79  tRNAHis guanylyltransferase
     54974 (THG1L)
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic type
  tRNA modification factors
   Other tRNA modification factors
    54974 (THG1L)
SSDB
Motif
Pfam: Thg1 Thg1C CowN
Other DBs
NCBI-GeneID: 54974
NCBI-ProteinID: NP_060342
OMIM: 618802
HGNC: 26053
Ensembl: ENSG00000113272
Vega: OTTHUMG00000130254
Pharos: Q9NWX6(Tbio)
UniProt: Q9NWX6
Structure
Position
5:157731420..157741449
AA seq 298 aa
MWGACKVKVHDSLATISITLRRYLRLGATMAKSKFEYVRDFEADDTCLAHCWVVVRLDGR
NFHRFAEKHNFAKPNDSRALQLMTKCAQTVMEELEDIVIAYGQSDEYSFVFKRKTNWFKR
RASKFMTHVASQFASSYVFYWRDYFEDQPLLYPPGFDGRVVVYPSNQTLKDYLSWRQADC
HINNLYNTVFWALIQQSGLTPVQAQGRLQGTLAADKNEILFSEFNINYNNELPMYRKGTV
LIWQKVDEVMTKEIKLPTEMEGKKMAVTRTRTKPVPLHCDIIGDAFWKEHPEILDEDS
NT seq 897 nt   +upstreamnt  +downstreamnt
atgtggggcgcctgtaaagttaaggttcacgattccttggccaccatttccatcactctg
agacggtacctgagattgggggcgaccatggcaaaaagcaagttcgagtacgtgagggac
ttcgaggctgacgacacctgcctggcacactgctgggtggtagtgcggctggacggccgg
aatttccatcggtttgctgagaagcacaactttgcaaaacccaatgacagccgtgctctc
cagctgatgaccaaatgtgcgcagactgtgatggaagaactagaggatattgtgatcgcg
tatggacagagtgatgagtacagctttgtgttcaagcggaaaaccaattggtttaaaaga
agagccagtaagttcatgactcacgtggcctcccagtttgcctccagctatgtgttttat
tggcgggattactttgaggaccagccccttctgtatcccccaggctttgacggaagagtc
gtggtgtatcccagcaaccagactttaaaggactacctcagctggcgacaagcagattgt
cacatcaataatctttataatacagttttctgggcacttatacaacaatctggactaaca
ccagtacaagcccaagggagattacagggaactcttgcagcagacaagaatgagattttg
ttttctgaattcaacatcaactataataatgagctgccgatgtataggaaagggactgtg
ttgatatggcagaaggtggatgaagtgatgacaaaagaaattaagctgccaacagaaatg
gaaggaaaaaagatggcagtgacccggaccaggacaaagccagtgcccttgcactgcgat
atcatcggggatgctttctggaaggaacatccagagattctagatgaagacagctga

DBGET integrated database retrieval system