KEGG   Homo sapiens (human): 54977
Entry
54977             CDS       T01001                                 

Gene name
SLC25A38, SIDBA2
Definition
(RefSeq) solute carrier family 25 member 38
  KO
K15118  solute carrier family 25, member 38
Organism
hsa  Homo sapiens (human)
Disease
H00982  Sideroblastic anemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    54977 (SLC25A38)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   54977 (SLC25A38)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 54977
NCBI-ProteinID: NP_060345
OMIM: 610819
HGNC: 26054
Ensembl: ENSG00000144659
Vega: OTTHUMG00000131289
Pharos: Q96DW6(Tbio)
UniProt: Q96DW6 A1LP07
Position
3p22.1
AA seq 304 aa
MIQNSRPSLLQPQDVGDTVETLMLHPVIKAFLCGSISGTCSTLLFQPLDLLKTRLQTLQP
SDHGSRRVGMLAVLLKVVRTESLLGLWKGMSPSIVRCVPGVGIYFGTLYSLKQYFLRGHP
PTALESVMLGVGSRSVAGVCMSPITVIKTRYESGKYGYESIYAALRSIYHSEGHRGLFSG
LTATLLRDAPFSGIYLMFYNQTKNIVPHDQVDATLIPITNFSCGIFAGILASLVTQPADV
IKTHMQLYPLKFQWIGQAVTLIFKDYGLRGFFQGGIPRALRRTLMAAMAWTVYEEMMAKM
GLKS
NT seq 915 nt   +upstreamnt  +downstreamnt
atgattcagaactcacgtccgtcgctgctgcaaccccaagatgtcggagacacggtggaa
acgcttatgttacatccggtgatcaaggctttcctgtgtggctccatcagtgggacctgc
tctaccctccttttccaacctctggatctccttaaaacacgcctgcaaaccctccagccc
tcagatcatgggtctagacgtgttgggatgttggctgtactcttgaaggtggttcgcacg
gagagtcttttgggcctttggaaagggatgtccccttccattgtgagatgtgtccctggc
gttggaatctactttggcactctctactctttgaagcagtatttcttgcgaggccatccc
ccaaccgccctggagtcagtcatgctgggggtgggctctcgctctgttgcaggggtctgt
atgtcacctatcactgtaatcaagacgcgctatgagagtgggaaatatggctatgagagt
atctacgctgccctgaggagcatctatcacagtgaggggcaccggggcctcttcagtggc
ctgacagcaactctccttcgagatgcgcccttctcaggaatctacctgatgttttacaac
cagaccaaaaatatagtgcctcatgaccaggtggatgcaacccttattcctattacaaat
ttcagctgtgggatatttgctggtattctggcctcactggtaactcaacctgcggatgtt
atcaaaactcatatgcagctttatccactgaagtttcaatggattggccaagcagtgaca
cttattttcaaagactatggactacgtggcttcttccaaggtggcatcccccgagccctc
cgcagaactctaatggcagcaatggcgtggacggtgtatgaagagatgatggccaagatg
ggcctgaagtcctga

DBGET integrated database retrieval system