KEGG   Homo sapiens (human): 54978Help
Entry
54978             CDS       T01001                                 

Gene name
SLC35F6, ANT2BP, C2orf18, TANGO9
Definition
(RefSeq) solute carrier family 35 member F6
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: EamA SLC35F Nuc_sug_transp CRT-like TPT UAA Mg_trans_NIPA Sugar_transport
Motif
Other DBs
NCBI-GeneID: 54978
NCBI-ProteinID: NP_060347
HGNC: 26055
Ensembl: ENSG00000213699
Vega: OTTHUMG00000128407
Pharos: Q8N357(Tbio)
UniProt: Q8N357
Position
2p23.3
AA seq 371 aa AA seqDB search
MAWTKYQLFLAGLMLVTGSINTLSAKWADNFMAEGCGGSKEHSFQHPFLQAVGMFLGEFS
CLAAFYLLRCRAAGQSDSSVDPQQPFNPLLFLPPALCDMTGTSLMYVALNMTSASSFQML
RGAVIIFTGLFSVAFLGRRLVLSQWLGILATIAGLVVVGLADLLSKHDSQHKLSEVITGD
LLIIMAQIIVAIQMVLEEKFVYKHNVHPLRAVGTEGLFGFVILSLLLVPMYYIPAGSFSG
NPRGTLEDALDAFCQVGQQPLIAVALLGNISSIAFFNFAGISVTKELSATTRMVLDSLRT
VVIWALSLALGWEAFHALQILGFLILLIGTALYNGLHRPLLGRLSRGRPLAEESEQERLL
GGTRTPINDAS
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggcctggaccaagtaccagctgttcctggccgggctcatgcttgttaccggctccatc
aacacgctctcggcaaaatgggcggacaatttcatggccgagggctgtggagggagcaag
gagcacagcttccagcatcccttcctccaggcagtgggcatgttcctgggagaattctcc
tgcctggctgccttctacctcctccgatgcagagctgcagggcaatcagactccagcgta
gacccccagcagcccttcaaccctcttcttttcctgcccccagcgctctgtgacatgaca
gggaccagcctcatgtatgtggctctgaacatgaccagtgcctccagcttccagatgctg
cggggtgcagtgatcatattcactggcctgttctcggtggccttcctgggccggaggctg
gtgctgagccagtggctgggcatcctagccaccatcgcggggctggtggtcgtgggcctg
gctgacctcctgagcaagcacgacagtcagcacaagctcagcgaagtgatcacaggggac
ctgttgatcatcatggcccagatcatcgttgccatccagatggtgctagaggagaagttc
gtctacaaacacaatgtgcacccactgcgggcagttggcactgagggcctctttggcttt
gtgatcctctccctgctgctggtgcccatgtactacatccccgccggctccttcagcgga
aaccctcgtgggacactggaggatgcattggacgccttctgccaggtgggccagcagccg
ctcattgccgtggcactgctgggcaacatcagcagcattgccttcttcaacttcgcaggc
atcagcgtcaccaaggaactgagcgccaccacccgcatggtgttggacagcttgcgcacc
gttgtcatctgggcactgagcctggcactgggctgggaggccttccatgcactgcagatc
cttggcttcctcatactccttataggcactgccctctacaatgggctacaccgtccgctg
ctgggccgcctgtccaggggccggcccctggcagaggagagcgagcaggagagactgctg
ggtggcacccgcactcccatcaatgatgccagctga

DBGET integrated database retrieval system