KEGG   Homo sapiens (human): 54981
Entry
54981             CDS       T01001                                 
Symbol
NMRK1, C9orf95, NRK1, bA235O14.2
Name
(RefSeq) nicotinamide riboside kinase 1
  KO
K10524  nicotinamide/nicotinate riboside kinase [EC:2.7.1.22 2.7.1.173]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00760  Nicotinate and nicotinamide metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    54981 (NMRK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.22  ribosylnicotinamide kinase
     54981 (NMRK1)
    2.7.1.173  nicotinate riboside kinase
     54981 (NMRK1)
SSDB
Motif
Pfam: AAA_18 AAA_33 AAA_14 CPT PRK AAA_22 SRPRB APS_kinase AAA_17 MobB KTI12 dNK nSTAND3
Other DBs
NCBI-GeneID: 54981
NCBI-ProteinID: NP_060351
OMIM: 608704
HGNC: 26057
Ensembl: ENSG00000106733
UniProt: Q9NWW6
Structure
Position
9:complement(75060577..75088155)
AA seq 199 aa
MKTFIIGISGVTNSGKTTLAKNLQKHLPNCSVISQDDFFKPESEIETDKNGFLQYDVLEA
LNMEKMMSAISCWMESARHSVVSTDQESAEEIPILIIEGFLLFNYKPLDTIWNRSYFLTI
PYEECKRRRSTRVYQPPDSPGYFDGHVWPMYLKYRQEMQDITWEVVYLDGTKSEEDLFLQ
VYEDLIQELAKQKCLQVTA
NT seq 600 nt   +upstreamnt  +downstreamnt
atgaaaacatttatcattggaatcagtggtgtgacaaacagtggcaaaacaacactggct
aagaatttgcagaaacacctcccaaattgcagtgtcatatctcaggatgatttcttcaag
ccagagtctgagatagagacagataaaaatggatttttgcagtacgatgtgcttgaagca
cttaacatggaaaaaatgatgtcagccatttcctgctggatggaaagcgcaagacactct
gtggtatcaacagaccaggaaagtgctgaggaaattcccattttaatcatcgaaggtttt
cttctttttaattataagccccttgacactatatggaatagaagctatttcctgactatt
ccatatgaagaatgtaaaaggaggaggagtacaagggtctatcagcctccagactctccg
ggatactttgatggccatgtgtggcccatgtatctaaagtacagacaagaaatgcaggac
atcacatgggaagttgtgtacctggatggaacaaaatctgaagaggacctctttttgcaa
gtatatgaagatctaatacaagaactagcaaagcaaaagtgtttgcaagtgacagcataa

DBGET integrated database retrieval system