KEGG   Homo sapiens (human): 5499Help
Entry
5499              CDS       T01001                                 

Gene name
PPP1CA, PP-1A, PP1A, PP1alpha, PPP1A
Definition
(RefSeq) protein phosphatase 1 catalytic subunit alpha
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03015  mRNA surveillance pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04114  Oocyte meiosis
hsa04218  Cellular senescence
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04270  Vascular smooth muscle contraction
hsa04390  Hippo signaling pathway
hsa04510  Focal adhesion
hsa04611  Platelet activation
hsa04720  Long-term potentiation
hsa04728  Dopaminergic synapse
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04810  Regulation of actin cytoskeleton
hsa04910  Insulin signaling pathway
hsa04921  Oxytocin signaling pathway
hsa04931  Insulin resistance
hsa05031  Amphetamine addiction
hsa05034  Alcoholism
hsa05168  Herpes simplex virus 1 infection
hsa05205  Proteoglycans in cancer
Network
nt06138  PKR-eIF2alpha signaling (virus)
nt06168  Herpes simplex virus 1 (HSV-1)
  Element
N00572  HSV ICP34.5 to PKR-eIF2alpha signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    5499 (PPP1CA)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    5499 (PPP1CA)
   04024 cAMP signaling pathway
    5499 (PPP1CA)
   04022 cGMP-PKG signaling pathway
    5499 (PPP1CA)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    5499 (PPP1CA)
   04218 Cellular senescence
    5499 (PPP1CA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    5499 (PPP1CA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    5499 (PPP1CA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    5499 (PPP1CA)
  09152 Endocrine system
   04910 Insulin signaling pathway
    5499 (PPP1CA)
   04921 Oxytocin signaling pathway
    5499 (PPP1CA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5499 (PPP1CA)
   04270 Vascular smooth muscle contraction
    5499 (PPP1CA)
  09156 Nervous system
   04728 Dopaminergic synapse
    5499 (PPP1CA)
   04720 Long-term potentiation
    5499 (PPP1CA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    5499 (PPP1CA)
 09160 Human Diseases
  09161 Cancers: Overview
   05205 Proteoglycans in cancer
    5499 (PPP1CA)
  09165 Substance dependence
   05031 Amphetamine addiction
    5499 (PPP1CA)
   05034 Alcoholism
    5499 (PPP1CA)
  09167 Endocrine and metabolic diseases
   04931 Insulin resistance
    5499 (PPP1CA)
  09172 Infectious diseases: Viral
   05168 Herpes simplex virus 1 infection
    5499 (PPP1CA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    5499 (PPP1CA)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    5499 (PPP1CA)
   03019 Messenger RNA biogenesis [BR:hsa03019]
    5499 (PPP1CA)
   03041 Spliceosome [BR:hsa03041]
    5499 (PPP1CA)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     5499 (PPP1CA)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     5499 (PPP1CA)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     5499 (PPP1CA)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     5499 (PPP1CA)
Spliceosome [BR:hsa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    5499 (PPP1CA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Metallophos STPPase_N
Motif
Other DBs
NCBI-GeneID: 5499
NCBI-ProteinID: NP_002699
OMIM: 176875
HGNC: 9281
Ensembl: ENSG00000172531
Vega: OTTHUMG00000167671
Pharos: P62136(Tchem)
UniProt: P62136
Structure
PDB: 

Position
11q13.2
AA seq 330 aa AA seqDB search
MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDL
QSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAD
KNKGKYGQFSGLNPGGRPITPPRNSAKAKK
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacagcgagaagctcaacctggactcgatcatcgggcgcctgctggaagtgcag
ggctcgcggcctggcaagaatgtacagctgacagagaacgagatccgcggtctgtgcctg
aaatcccgggagatttttctgagccagcccattcttctggagctggaggcacccctcaag
atctgcggtgacatacacggccagtactacgaccttctgcgactatttgagtatggcggt
ttccctcccgagagcaactacctctttctgggggactatgtggacaggggcaagcagtcc
ttggagaccatctgcctgctgctggcctataagatcaagtaccccgagaacttcttcctg
ctccgtgggaaccacgagtgtgccagcatcaaccgcatctatggtttctacgatgagtgc
aagagacgctacaacatcaaactgtggaaaaccttcactgactgcttcaactgcctgccc
atcgcggccatagtggacgaaaagatcttctgctgccacggaggcctgtccccggacctg
cagtctatggagcagattcggcggatcatgcggcccacagatgtgcctgaccagggcctg
ctgtgtgacctgctgtggtctgaccctgacaaggacgtgcagggctggggcgagaacgac
cgtggcgtctcttttacctttggagccgaggtggtggccaagttcctccacaagcacgac
ttggacctcatctgccgagcacaccaggtggtagaagacggctacgagttctttgccaag
cggcagctggtgacacttttctcagctcccaactactgtggcgagtttgacaatgctggc
gccatgatgagtgtggacgagaccctcatgtgctctttccagatcctcaagcccgccgac
aagaacaaggggaagtacgggcagttcagtggcctgaaccctggaggccgacccatcacc
ccaccccgcaattccgccaaagccaagaaatag

DBGET integrated database retrieval system