KEGG   Homo sapiens (human): 54991
Entry
54991             CDS       T01001                                 
Symbol
C1orf159
Name
(RefSeq) chromosome 1 open reading frame 159
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: DUF4501
Other DBs
NCBI-GeneID: 54991
NCBI-ProteinID: NP_001317235
HGNC: 26062
Ensembl: ENSG00000131591
Pharos: Q96HA4(Tdark)
UniProt: Q96HA4
Position
1:complement(1081823..1116089)
AA seq 380 aa
MALRHLALLAGLLVGVASKSMENTVTRNSTAVINTQAEGTLSPPGLSSLPVVREWALTHT
AQLPECCVDVVGVNASCPGASLCGPGCYRRWNADGSASCVRCGNGTLPAYNGSECRSFAG
PGAPFPMNRSSGTPGRPHPGAPRVAASLFLGTFFISSGLILSVAGFFYLKRSSKLPRACY
RRNKAPALQPGEAAAMIPPPQSSGNSSCRIPLWGFPSLGQSQGALWVCPQTGLPGSGSRP
PLPGSPGDPPTRQGQGRIWLVPPALDLSWIWPAPPARPPLIPVTSMLFPVPETWGLQERR
THHDRADPQYLLLLEVQLHPRTDAAGLRQALLSSHRFSGAGSGGPKSQPVRKPRYVRRER
PLDRATDPAAFPGEARISNV
NT seq 1143 nt   +upstreamnt  +downstreamnt
atggcgctgcggcacctcgccctcctggctggccttctcgtgggagtcgccagcaagtcc
atggagaacacggtcacgagaaacagcacagctgtgatcaacacacaagctgagggtacc
ctgagccccccaggcctgtccagtctgcctgtggtcagggaatgggccctcacacacacc
gcccagctgcccgagtgctgtgtggatgtggtgggcgtcaacgccagctgcccaggcgca
agtctgtgtggtccaggctgttacaggcgctggaacgcggacgggagcgccagctgcgtc
cgctgtgggaacggaaccctcccagcctacaacggctccgagtgtagaagctttgctggc
ccgggtgcgccattccccatgaacagaagctcagggacccccgggcggccacatcctggg
gctccgcgcgtggccgcctccctcttcctgggcacgttcttcattagctccggcctcatc
ctctccgtagctgggttcttctacctcaagcgctccagtaaactccccagggcctgctac
agaagaaacaaagctccggccctgcagcctggcgaagccgctgcaatgatccccccgcca
cagtcctcaggtaacagcagctgtcgcatccccctgtggggtttcccatctctgggccag
tcccagggtgctctgtgggtttgtccccaaacgggtttgcctggctctggatctcggcca
cccctgcccgggtccccaggagacccacccacaaggcagggccagggccggatttggctg
gtgccccctgctctggatctcagctggatttggccggcgccccctgcccgccccccttta
atccccgtgacttccatgctctttcctgttcccgagacgtggggtctgcaggaaaggagg
acccaccacgacagggcagacccccaatacctgctcctccttgaagtccagctccacccg
aggacagacgcagccggcctccgccaggccctcctgagcagccatcgcttcagtggtgct
gggtcaggcggacccaagagtcagcccgtacggaagccgcgctacgtcaggcgggagcgg
cccctggacagggccacggatcccgctgccttcccgggggaggcccgtatcagcaatgtc
tga

DBGET integrated database retrieval system