KEGG   Homo sapiens (human): 54998Help
Entry
54998             CDS       T01001                                 

Gene name
AURKAIP1, AIP, AKIP, MRP-S38
Definition
(RefSeq) aurora kinase A interacting protein 1
  KO
K16830  aurora kinase A-interacting protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    54998 (AURKAIP1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     54998 (AURKAIP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF1713
Motif
Other DBs
NCBI-GeneID: 54998
NCBI-ProteinID: NP_001120701
OMIM: 609183
HGNC: 24114
Ensembl: ENSG00000175756
Vega: OTTHUMG00000001413
Pharos: Q9NWT8(Tchem)
UniProt: Q9NWT8
Position
1p36.33
AA seq 199 aa AA seqDB search
MLLGRLTSQLLRAVPWAGGRPPWPVSGVLGSRVCGPLYSTSPAGPGRAASLPRKGAQLEL
EEMLVPRKMSVSPLESWLTARCFLPRLDTGTAGTVAPPQSYQCPPSQIGEGAEQGDEGVA
DAPQIQCKNVLKIRRRKMNHHKYRKLVKKTRFLRRKVQEGRLRRKQIKFEKDLRRIWLKA
GLKEAPEGWQTPKIYLRGK
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgctcctggggcgcctgacttcccagctgttgagggccgttccttgggcaggcggccgc
ccgccttggcccgtctctggagtgctgggcagccgggtctgcgggcccctttacagcaca
tcgccggccggcccaggtagggcggcctctctccctcgcaagggggcccagctggagctg
gaggagatgctggtccccaggaagatgtccgtcagccccctggagagctggctcacggcc
cgctgcttcctgcccagactggataccgggaccgcagggactgtggctccaccgcaatcc
taccagtgtccgcccagccagataggggaaggggccgagcagggggatgaaggcgtcgcg
gatgcgcctcaaattcagtgcaaaaacgtgctgaagatccgccggcggaagatgaaccac
cacaagtaccggaagctggtgaagaagacgcggttcctgcggaggaaggtccaggaggga
cgcctgagacgcaagcagatcaagttcgagaaagacctgaggcgcatctggctgaaggcg
gggctaaaggaagcccccgaaggctggcagacccccaagatctacctgcggggcaaatga

DBGET integrated database retrieval system